SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000012492 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000012492
Domain Number 1 Region: 73-120
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000034
Family Elafin-like 0.0013
Further Details:      
 
Domain Number 2 Region: 22-74
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000693
Family Elafin-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000012492
Sequence length 125
Comment (Ornithorhynchus anatinus)
Sequence
KMAHGLFLLVALLVLGMQVPAACWRRKGEKLGGCPADDTPCLWQRPDQCSEDSQCPRLKK
CCSRACYRQCLPPVRVKLGDCPKDDLLCLSPIQHLCGKDTDCSGIQKCCLAACGRDCREP
AKGTC
Download sequence
Identical sequences F6W6F2
ENSOANP00000012492 9258.ENSOANP00000012492 ENSOANP00000012492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]