SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000013861 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000013861
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily SNARE-like 1.72e-32
Family Synatpobrevin N-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 121-166
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000523
Family SNARE fusion complex 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000013861
Sequence length 168
Comment (Ornithorhynchus anatinus)
Sequence
MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRI
IYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKYHSEN
KGTDRVVETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSV
Download sequence
Identical sequences 9258.ENSOANP00000013861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]