SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000014490 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000014490
Domain Number 1 Region: 1-123,155-261
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.81e-71
Family Calponin-homology domain, CH-domain 0.0000441
Further Details:      
 
Weak hits

Sequence:  9258.ENSOANP00000014490
Domain Number - Region: 346-418,607-651
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0192
Family Spectrin repeat 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000014490
Sequence length 1013
Comment (Ornithorhynchus anatinus)
Sequence
EQEHTQKKTFTCWINSQLAKHVPPSAISDLYTDIKKGHVLLDLLEVLSGQQLTREKGTNP
FQCRSNIEQVLVFLKNRSVSRDFMIKLINIHVTDIIEGNPSIVLGLIWTIILHFHIEELA
WTLSCSYNQPSLDCVTVVDLSPTSSPPAKRRSKAQARWKMSAKKALLLWAREQCAPHCTV
SITDFKSSWRNGMAFLAVIHALRPDLIDMNIVKDRSNRENLNEAFRIAECELSIPRLLEP
EDVDVLHPDEKSIMTYVAQFLQYSKDLPVAEDESFAGSRIILNKELNTVTEFFYLDSSTL
AMTDKKVHSGIKNQDMHSFLETFNEEKKAFLSVLSLKKNMVGMTDDQLHLREAWDRLTDQ
INEWRAKLDHILPSPLDRVEAWLQEVEHLMAEDLPAFQDYSNAMTFVEEKLHLLKGLMDN
FDCHLNTLLAFENKDQKHMPLIPPDKLEEMKKTFNDVKGTDFIALLEFHYYLGSVQGLID
EVKSKLHFWNIKYGTKESVELLLQDWHNFIEKRDVPAQLDASFQKLQQNVDNYMKRGGDP
QNISKQFKIVASQISACRKYIYKVKSTLQKVLSSWDTYTKNLHFLKFSLEESKKEHPKEE
FFLSNKHLVQAHGNLNEAGNFLMEVSNDQVGLSIAKDLKKLNRRWAKFIKKTQFELKLQP
VNKEQKQLLDNNGNTELCREEKLSIPSESIDLSTEVLKRHIRDLKHHVVLNLPLLKIQTR
SNLFLNIQEVWTSLLLKVEELLSYLGKIKEENEGEIKESSSLLRRVEEVEKLINQVETWE
AETRPILNLLQHQSSMEGSTEESLQHLIAKGSACRDHISMAEDILQTVTHGVSRQGSLQH
FHTTGLQAQIEEAKDKIQVSVKYSGSLKAEPSASEKEIRVRFEESRKELESCITKALKLL
GSKASCEDPASEHKEALSILDSKSFDKFLEAAAQQKSISPAHAKLAVEEQSQELCEKWKA
VSQEIVSYICILKVEIEKGKLNEILSKLEKQINKEEKCISKGRTKGLAKQHEV
Download sequence
Identical sequences F7G1U9
9258.ENSOANP00000014490 ENSOANP00000014490 ENSOANP00000014489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]