SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000016027 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000016027
Domain Number 1 Region: 202-323
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-33
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000016027
Sequence length 326
Comment (Ornithorhynchus anatinus)
Sequence
SLDQVELGETELRRPSASPVVENGHQPNSGEQRDRRGLGEETGRASPPTEAHLPSITLRR
PHHPVTATTRVPERFSGETSTQHPFSTAAGALGSPSKIPGEVATRTSGQPAAHSTSGTRG
LAVEGELGPPKTGRDPPERVSPPPPSPPGPLGVQGSAPRPGERRRELVRSQTLPRTSGTQ
ARRALFEKLEQDTGKGKGESRAKLKRSQSFGVASASSIKQILLDWCRSKTVGYQHVDLQN
FSSSWSDGMAFCALVHSFFPEAFDYNSLNPGNRQKNFELAFTTAEEFAHCDRLIEVEDMM
VMGHKPDPMCVFTYVQSLYNHLRRFE
Download sequence
Identical sequences F7FL92
ENSOANP00000016028 9258.ENSOANP00000016027 ENSOANP00000016027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]