SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000019659 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000019659
Domain Number 1 Region: 450-552
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.24e-29
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000019659
Sequence length 1240
Comment (Ornithorhynchus anatinus)
Sequence
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQP
GIKNPYRGVVVWPVPENIEITVTLFKDPHAEEFEDKEWTFVIENESLSGRRKALATSSIN
MKQYASPMPTQTDVKLKFKPLSKKVVSATLQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEEDEENRVNQEEKAAKITEIVNQLNALSSLDEDQDDCIKRANMPSAK
SASSSEELINKLNFLDEAEQNLANPFGDPDGAELNPFGDPDAEEPSPETASSSKAEESFP
NNSYSPFKEVETPQYLNPFDEPDPEPETALSTIKDSPPQPTKRKNVRPVDMSKYLYADTS
KTEEEELDESNPFYEPKLTPTQNNWVTPAQDLETERRMKRKAPAPPVLLPKSEGGVSENT
LVISAGRELSSSPKLSPIPSPVLGRKPNASQSLLVWCKEVTKNYRGVKITNFTTSWRNGL
SFCAILHHFRPDLIDYKSLNPQDIKENNKKAYDGFASIGISRLLEPSDMVLLAIPDKLTV
MTYLYQIRAHFSGQELNVVQIEENSSKSTYKVGNYETDTNSSVDQEKFYAELNDLNREPE
LQPAVSGAVDFVSQDDSVFVNDSGVGESESEHQTPDDHLSPSTASPYSRRTKSDMDPQKS
QQSSGRASGSEEAGSGTSSDLVQTQIVLEKKKLLKADTLELSEFSLVTDQRKDVCPPFAC
EDIDRQRHQTPESCGSYLEQEKLEYSGTSESRRSDPESPVKKTSLSPTSKLGYSYNRDAD
LAKKKRATLRHIESNSDSDSRITLNNADYSAKMTQQRILSRQEELKERARVLLEQARRDA
ALKAGSKQIINASPPVRNNQLTDQQDEERRRQLRERARQLIAEARSGVKMSELPSYGEMA
AEKLKERSKASGDEDDNIEIDTNEEIPGDFVMESGDELTNLGNDLDYAAEQHSKSMDMNL
KKLLETQPQVENSFSSATQKTITDSSEQGVKNGTEDPHIERLQKATERFKNPVVFSKDST
VRKTQLQSFSQYVENRPEMKRQRSIQEDTKRGNEEKAAITETQRKPSEDEVLNKGFKDTS
QYVVGELAALENEQKQIDTRAALVEKRLRYLMDTGRNTEEEEAMMQEWFMLVNKKNALIR
RMNQLSLLEKEHDLERRYELLNRELRAMLAIEDWQKTEAQKRREQLLLDELVVLVNKRDA
LVRDLDAQEKQAEEEDEHLERTLEQNKGKMAKKEEKCVLQ
Download sequence
Identical sequences F7DKC3
ENSOANP00000019659 ENSOANP00000019659 9258.ENSOANP00000019659 XP_001511121.1.37387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]