SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000020518 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000020518
Domain Number 1 Region: 634-738
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-31
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 
Weak hits

Sequence:  9258.ENSOANP00000020518
Domain Number - Region: 341-441
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0139
Family Myosin rod fragments 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000020518
Sequence length 740
Comment (Ornithorhynchus anatinus)
Sequence
VERSRKGSSGASEVSVACLTERIHQMEENQHSTSEELQATLQELADLQQITQELNSENER
LGEEKVILMESLCQQSDKLEHFSRQIEYFRALLDEHHVSYVIDEDVKSGRYMELEQRYMD
LAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKERNHHMERIIESEQKSKAA
LANTLDEYKATVAGDQIEMNRLKAQLENEKQKVAELYSIHNSGDKSDIQDLLESVRLDKE
KAEALAGSLQEDLAHTRNDANRLQDTIAKVEDEYRAFQEEAKKQIEDLNMTLEKLRAELE
EKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKKLQDQKHDMEREIKTLHR
RLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLHEAQEKNEKLTKELEEIKS
RKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEPTPTVKTLIKSFDSASQVPNP
TVAAIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISASKPLTTLSDKRPSYAEIPGQEHL
LRTSSTSRPSSLPRVPAMESAKSISVSRRSSEEIKRDISAPDGASPASLMAMGTTSPQLS
LSSSPTASVTPTTRSRIREERKDPLSALAREYGGSKRNALLKWCQKKTEGYQNIDITNFS
SSWNDGLAFCALLHTYLPAHIPYQELNSQDKRRNFTLAFQAAESVGIKSTLDINEMVRTE
RPDWQNVMLYVTAIYKYFET
Download sequence
Identical sequences F6U1G8
ENSOANP00000020518 9258.ENSOANP00000020518 ENSOANP00000020518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]