SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000021740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000021740
Domain Number 1 Region: 4-121
Classification Level Classification E-value
Superfamily Hormone receptor domain 6.93e-27
Family Hormone receptor domain 0.00000659
Further Details:      
 
Domain Number 2 Region: 127-234
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000146
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000021740
Sequence length 270
Comment (Ornithorhynchus anatinus)
Sequence
THSDCIFRKEQEICLEKIQRLTALIGINESSPGCPGMWDNITCWKPAGVGEMVIVSCPAL
FRIVNSEEEKKAGETVGPGGRGPVRFPQLQHMGLVSRNCTDEGWSEPFPHYFDACGFDVN
ETESENQDYYYLSVKALYTVGYSTSLVSLTTAMVILCRFRKLHCTRNFIHMNLFVSFILR
AISVFIKDGILYAEQNSNHCFVSTVECKAVMVFFHYCVMSNYFWLFIEGLYLFTLLVETF
FPERRYFYWYTVIGWGRPPLCVPPWRVPRL
Download sequence
Identical sequences 9258.ENSOANP00000021740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]