SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000023981 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000023981
Domain Number 1 Region: 25-172,218-328
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.15e-40
Family Calponin-homology domain, CH-domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000023981
Sequence length 330
Comment (Ornithorhynchus anatinus)
Sequence
VSGLQDTGKTAVDSSSSPSDPSTACLHLENVHLAENEERKMIDPNSKEDSRFKELLQVLT
DWMNGVLAKERVIVKQLEEDLYDGQVLHKLLEKLSGLKLSVAEVTQSEVGQKQKLQTVLE
AMQGLLRPHGRPIRWTVDAIHSKNLVATLHLLITLVTHFQAPIRLPEHVSVQVVVVRKRE
GVLYSTKVTEELTTSMEMMMGRSKRDAMDTLFDHAPDKLIMVKQSLIIFVNKHLNKLNLE
VTELETQFADGVYLVLLMGILGHYFIPLHHFYLTPDSFEHKVHNVALAFELMQDAELKKP
ETLPEDIVNLNLKSTLRVLNNLYVRYKNAE
Download sequence
Identical sequences 9258.ENSOANP00000023981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]