SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000024509 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000024509
Domain Number 1 Region: 5-100,131-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.64e-64
Family Calponin-homology domain, CH-domain 0.0000815
Further Details:      
 
Domain Number 2 Region: 8011-8166
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-20
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 3 Region: 7792-7916
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-20
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 3077-3233
Classification Level Classification E-value
Superfamily Spectrin repeat 4.65e-19
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 1583-1718
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-19
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 7053-7186
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-17
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 7 Region: 5006-5164
Classification Level Classification E-value
Superfamily Spectrin repeat 2.76e-17
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 8 Region: 7367-7515
Classification Level Classification E-value
Superfamily Spectrin repeat 1.33e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 9 Region: 3231-3351
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 10 Region: 2419-2553
Classification Level Classification E-value
Superfamily Spectrin repeat 4.98e-16
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 11 Region: 4467-4624
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000144
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 12 Region: 6930-7052
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000497
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 13 Region: 6719-6859
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000408
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 14 Region: 2637-2774
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000432
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 15 Region: 3879-3995
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000533
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 16 Region: 1366-1498
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000106
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 17 Region: 7920-8029
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000173
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 18 Region: 3768-3884
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000249
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 19 Region: 4250-4405
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000763
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 20 Region: 520-658
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000096
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 21 Region: 7582-7725
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000418
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 22 Region: 3527-3659
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000432
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 23 Region: 5885-6025
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000182
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 24 Region: 5673-5777
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000314
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 25 Region: 7258-7377
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000379
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 26 Region: 2787-2904
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000162
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 27 Region: 2313-2432
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000208
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 28 Region: 2207-2362
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000648
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 2010-2149
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000131
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 30 Region: 3340-3454
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000016
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 31 Region: 1671-1824
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000165
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 32 Region: 1887-2035
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000972
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 33 Region: 5135-5237
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000158
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 34 Region: 5480-5596
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000168
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 35 Region: 2989-3089
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000176
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 36 Region: 842-975
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000277
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 37 Region: 4918-5016
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000187
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 38 Region: 1508-1616
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000619
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 39 Region: 3960-4094
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000971
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 40 Region: 1047-1186
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000983
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 41 Region: 3420-3522
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000157
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 42 Region: 6337-6442
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000183
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 43 Region: 4789-4902
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000072
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 44 Region: 6035-6148
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000749
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 45 Region: 6643-6756
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000918
Family Spectrin repeat 0.003
Further Details:      
 
Weak hits

Sequence:  9258.ENSOANP00000024509
Domain Number - Region: 6513-6597
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000131
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 5248-5340
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000302
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number - Region: 4167-4294
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000411
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number - Region: 1251-1363
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00372
Family Spectrin repeat 0.022
Further Details:      
 
Domain Number - Region: 4647-4740
Classification Level Classification E-value
Superfamily Spectrin repeat 0.016
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 2556-2626
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0241
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 5586-5650
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0648
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000024509
Sequence length 8374
Comment (Ornithorhynchus anatinus)
Sequence
QRNPPMMVDDLFEDMKDGIKLLALLEVLSGQKLPYEQGRHMKRIHSVANIGTALKFLEGR
RIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSTSSVDSLVSSE
TSSPPNKRKVGTKIQGNAKKALLKWVQHTAAKQAGIEVKDFGRSWRSGVAFHSVIHAIRP
ELVDLEKVKRRSNRENLEEAFTIAEVELGIPRLLDAEDVDVDKPDEKSVMTYVAQFLKHY
PDPHNTAMDGQENDDPLQAIPTFAISIPKLKREDRLMLRDLKVWVEQFERDLTRAQVVET
SFRDRYQAFKHFRVQYEVKRKQIELAIQPLRKDGKLSLDQAMVKQAWDRVTSRLFDWHIQ
LDKSLPVPLGTIGTWLYRTEIALREDIVIQQVHEETANTIHRKLEQHKDLLKHVDGHKKV
FQEIYRTRSVNGVPIPPEQLEDMAERFNIVSSTSELHLKKMEFLELKYRLLSLLVLAESK
LKSWIIKYGRRESVELLLQNYISFIENSKFFEQYEVTYQILKRAADMYVKADGSVEEAEN
VMKFMNETTAQWRNLSVEVRSVRSMLEEVISNWDRYSSIVASLQAWLEDAEKMLNQSEYA
RKDFFRNLPHWIQQHTAMNDAGNFLIETCDETVSRDLKQQLLLLNGRWRELFMEVKQYAR
ADEVERMKKEYLDHVTTLSIYTAGAIGKLSEFLEISSLNVRIFIQDLEDIKQRVPVMEAQ
YKKITKTAQIITKESPQEEVNEMLATLSGIKDQLNKVKEYYPPLLYESQQLLIPLEDLEK
QITSFYESLEKINEIISLLDHEAQSTVIFKQKYQELSTCQEKCKVTLTLIEEGSQTIQRF
VALSKVIKHFDQTALQRKVAEVHVAFQNMTKKTTDWRKNVETNSRLMNKFEESRSELEKV
LHNAQSCINEKGNPEALLKKHTEFFSQLDQRVLNAFLKACDELTDILPEQEQQSLQEAVR
KLHKQWKDLQAEAPYHLLHLKVEVETNRFQATVEECRAELARETKLLLQESSERIIKEHR
VFFSENGPQHLCEKRLQLIEELCLKLPERDPGRTAPESCRKTLRNLKAQIDKTSAKLMEH
PDKWKDYKIRFLDLSSWISSKEQQLKQIKREAKDTTKYGDIKPAAEGIRDEVSKQGECLS
WLKSRLKFLTEVSTAMEAEKQADELSKVSSDFKKLVTLLAEVEKMLSSLGDCVQYKEIVK
YSLEELISSSKKVQEQAEAILDSENLFEAQQLLLHHQQKTKMIQAKKKDVQQQLARAQGE
GEMPRRVQEELKKLEGTMDHMEQTTERQERRLQVTIRKWERFEANKETVVRYLFQTGSHH
ERFLSFSSLESLSSELDQTKEFSKRTEAVAVQAQNLVKEASEIQLGCKNKEVLQQQATSI
QEQVKKLEDTLEEDIKTMEMVKKKWENFGNNFESLSVWITEKEKELDGLETSSSPLDMQI
SQIKGIIKDINDRTSGIPDLEEATQSFAQYITTGESARIKAKLTQIRRYWEELREHGQCL
EGMILGNASQQQKFDESLTKIQQCLSEFDAKLEEPVIICSSATETYKVLQEHMDLCQALA
SMNNTITSFSASARKVINKDTAFQEATNLQQRYERTIGKAKERQTMLENLLLHWQRLEKE
LSTFLTWLERCEASASSPEKDISADRVKLEGELQLVQTLQDEVVGHASLYSSLLQMKESL
FSVASKDDVKVIKLQMEQLEERWRVLPQIISKRISFLQSVVAEHQQFDELLLHFSVWIKQ
FLAELHSSSEINIVDHQATLVRCKDHSVEVEGKKQEMLCLKGHLGKLCSFSRGEDHHILQ
SKTEDCFQLFQEACQITERRQLALTQIGNFLQLHASLSGVLQRLRQTVEATSSMDKAQSD
LLKKDLNAAIQDTKKLESTAIGLDGVLSKAQYHLKSSTSEQRTSCRATADQLSLQLEAIQ
NLLGTKQGEAEALGLLKKAFMDHKEELLKCIEDIEERTDKERLKEPTRQALQQRLRAFNQ
LEDELNSHEHELSWLKDKAKQIAQKDISLAPEIDREINRLEVTWDDTKTLIHENQGQCCG
LIDLMREYQSLKSAVSKVLENASNVTVIRPTVKDQEDIRWTISKHEMAKNEMNEKQKDLN
DFTSKGKRLLSELKRIHSSDVLLVKTDMDSTVDKWLDVSEKIEENVDRLSVSLSIWEDVL
TARDEIDGWTNNSIPQLNESISNLNSSIKTETFLKEFESEVKNKGLKLEELHSKVLDLKE
LTKNPETPADLQFIEADLRQKLEHAKEMSEIAKGTLKDFSAQTTQLEKCIHDTTAWLTKM
EDTLLCCAQTPNCESLKKMREIQKELQIQQSSIDSAQETLNGLCRKYHSVELESLGATMT
ELVKKFETVSQLGSKTQASLQDTLDRRFNASMQEFQEWFSGIKAAVRESSDRSGDSKAIE
AKLHDLQRILDSINEGQNKLDTVTQEGQNLFAYLPKQIVSTIQEQITTANEEFQAFLKQC
LKDKQALQDCASELGSFEDQHKKLSLWIHEMEERLSTESLGENKQHIPEKKNEFHKVEMF
LGELLAARESLDKLSQRGQILNEEGHGAGKEVRLAAQLLTGYQNLVKITKEKLRSCQIAL
QEHQALEAALQSMWSWIKDIQEKLASAESMVGSKATLEKRLFQIQEIILMKGEGDVKLNM
AIGKGEQALRSSNREGQKVIQAQLQTLRDVWANITSSSTHAQSCLESVISQWNDHLERKS
QLEQWMESIDRRVAEPIQRKASLKEKFSQLDYCQAIVSEAEEHTGALHRLTEKSKELYEK
TEDDSFKEAIQEELKTQFNDITTIAKEKMRKVEEIVKDHLMYLDAVHEYTDWLHSAKEEL
QRWSDVSGDSCATQRKLSKIKELIDSRQIGASRLNRVESLAPTVKQNTTASGCELLDTEM
QALQSDWKHWEDSVFQTQSCLEELVSQMALSEQEFSAQVAQLEKALQDFSALLETWSQQL
TLLEGKNTDNEIVECWHQEKDILEALRKAEPMTDELKAHLNDLCRFSRDLSPYSTKVSGL
IKEYNSLCLQASKRCQNKEQTLQQRFRKALRDFQQWVINAKITTAKCFDLPQSINEASAS
LQKIQEFLSESENGQHKLNMVVSKGEMLNGLLSEEKAKDVQTKVDRAKEDWKNFHSHLHQ
KESTLENLKIQMKDFEVTAEPLQDWLNKTEKMVRDSSSRLHDLPGKRREQQKLQSVLEEI
NCHEPQLHRLKEKAQQLWEGQAASKSFMHRVSQLSSQYLALSNLTKEKVSRLDRVVAEHT
QFSVGIKELQDWMADAIHMLESYCHPTSDKSVLDSRMLKLEALLSVKQEKEIQMRMVLTR
GELVLQNTSPEGVPTIQGQLQAVKDMWAALLTTGIRCKSQLEGALSKWTSYQDDVRQFSN
WMDSVEASITACERQCAELRDKTTALGKVKLLSEEVLSHDNLLETIEMKGVGMTEHYVTQ
LELQDLQERYSAIKDRTKEAVTKSERIVRLHQEYQNDLKVFEVWLQQEQEKLDRFSLLEG
DAQTHDTALRELQELQVRCAEGQALLNTVLHTREEVLPWGIPQVEDRILESVRQDWHTYQ
QRLSEIRTQFNSTVNKLRVMEQKFQQVDEWLKTMEDKGSIRAGRQSNRATKEMQLQQMKK
WHEEITSYKDEVEEVGTRAQELLEESHVSSRMGCQATQLTSRYQTLILHVLEQIKFLEEE
IQSLEESEQAFTSYVEWYGSTHKNFKNVSSEIDKVDKIMMGKKMKTLELLLSDMEKGHSL
LKSAREKGERAVKYLEDGEREKLKSELHVHMEQLEELASTVRREHTILEKCLHLAKEFSD
KYKVQTQWLAEYQAILQTPEEPKTELYEKKAQLSKYKSIQQMVLSHEPSVKSVNEKGEAL
LEMVHDATLRDKIQKLQTDYQELCNAGKEHVSSLELKVKEHEDYNSELQEVEKWLLQMSG
RLVTPDLMEISSLETITQQLANHKAMMEDIAGFEDRLDSLKNKGDCLINQCADHLQAKLK
QNVQAHLQGIKDSYSAICSTAQRVYQSLEHELQKHVSRQDTLQQCQAWLSAVQPDIKPNP
QPPFCRADAAKQVKQFRALQEQARTYLDLLCSMCDLSNPEVKTTAKSIQQTKQMIEQEIN
RSQNLNQGWEEIKQMKTELWIYFQDADQQLQNMKRRQAELELNIAQNIVSQVKEFVQKLQ
SKQTSVTAVTEKVNKLTQGQESPEHSEIGHLRNQWMDLCLQTNSLLLQREEDLQRTRDYH
DCLNVVEVFLEKFTKEWDNLARSDADSTTVHLEALKKLAEALEEKRYAIGDLKDQKQKMM
DHLNLDDKELVKEQTRHFEQRWFQLEDLIKKKIQVSVTTLEELNLVQSRFQDLMEWAEEQ
QPSISEALQHSPPPDLAQNLLMDHLAICSELETKQMHLKSLIKDADRVMADLGLNERQLI
QKVLSDAQSHMHSLTNLVDQKRKFLNKAVSEKTQFLIAVFQATSQIQQHERKITFHEHIC
LLPDDVGKQVKTCKSTQASLKTYQNEITGLWAQGRELMKEATEQEKYEVLSKLQELQSVY
DTVLQKCSQRLQELEKNMVSRKYFKEDFDKMCHWLKQADIVTFPEINLMNGNNGLYSQLA
KYQQILEQSPEYENLLLTLQRSGQEILPTLNEVDHPYLEEKLSSLPQQFSVVVALAKDKF
YKVQEAILARKEYASLIVLTIQALSELEDQFLTMDKAPKSLLAEEAFTLQEGCKALLGEA
LSLGAAVDELNQKKEGFRSTGQPWEPEEMLQLVTLYHKLKRQVEQRLSLLEDTTTACQKY
EDLCQQLKKQLESVRKEQIQVNEETLPVEEKLKAYHALAGSLQDSGILLKQVNEHLEDLS
PHLDPEVYEAASHQVQLWQEELKSLTATIGETVMECENRLVQSIDFQTEICRSLDWLRRV
KAELSGTLSLDLKLQNIQEEIRKVQIHQEEVQSSLRIMNALSSKEKEKFMKAKELISADL
ENTLAELSELDAEVQEAIRIRQATLTETYSLCQKYYQVIQAGSDWLEDAQELLQLAGNGL
DVESSEENLKNHVEFFNTKPQFHGFLEELQDLMSKLEPFIKSSGKEELKKNVACLEQKGK
GIKRESQAQLELLQSCATQWQDYQKAREEVIELMNEAEKKLSEFSVSRASSSQEAEEKLL
EHKSLVSVVNSFQERITALEERASQLEQIGNDASKATISRSMTTVWQRWNRLCSVTRDQE
NILKDARDEWQAFNSKVQKATERIDQLQDNLPGSSAEKASKAELSVLLDHHDTFVLEVEQ
QQSALGLLKQQAVNMLRDVEMEPAAGKKPPVMQEITAMQDRCHNIQEKVKKSGKLVKQEL
KEREVVEAEINSVKSWIQEAKEYLMNPTMEIDAQLDELQALLTEAGTHRQAIEKIAEEQQ
NKYLGLFAILPSELSLQLAEVALDLGATNDQIQAKVKEGQQSKAMNQEFSQKIQGVTKEL
TTILTKLKTKTNNLAQAKIDQKILGEELDACNVKLIELDVAVRDFTEQNSQLAKKLSKKI
GKLTELHQQTIRQAEYRLSKLNQAAAHLEEYNEMLEFILKWIEKAKVLIHGNITWNSASQ
LRDQFISHQSMLEESGEIHSDLEAMNEKLEYLASVYCTEEMSQQLSELGRETEELRQVIR
LRMQNLQDAAKDMKKFEIELKTLQNALEQAQMTLTSPEFGRLSLKEQLSHRQHLLSEMES
LKPKVQAVQICQVALRIPEEMVTSLPICHTALRLQEEASRLQHTAIQQCNIMQEAVVQYE
QYEQEMKHLQQLIEEAHREIQDKPVATSNIQELQAQISRHEELAQKIKGYQEQIASLNSK
CKMLTMKAKHATMLLTVTEVEGMEDLDTELLSTHSAHPSVVMMTAGRCHTLLSPVTEESG
EEGTNSEISSPPACRSPSPVANTDASVNQDIAYYQALSAEQLQTDAAKIQPSTSSTQESY
EPGLESTASAKLDDLQRSWETLKNVISEKQRTLYEALERQQKYQDSLQSISSKMEAVEVK
LNESLEPGKSPESQMAEHQALMDEILMLQDEINELQTSLAEELVSESLEMDAADQLALQS
TLTVLAERMSTIKMKASGKRQLLEEKLNEQLEEQRQEQALQRYRCEADELDHWLLNTKAT
LDTSLVTSEEPMDMEDQLVDCQNMLVEIEQKVVALSELSVHNENLLMEGKAHTKDEAEHL
AVKLRTLKGSLLELQRALYDKQINIQGTSQEKEECEAELAAAQSPSVQEWLAQARTTRSQ
QQQSSLQRQKELEQELAEQKNLLRSVASRGEEILTQHTSIDGSSLSSSEKPDVLSQELGS
ESEKTSTEDQMRMKWESLHQEFSTKEKLLKDALEQEQDQLLYSRPNRLLAGVPLYKGEGQ
AQDKSSVASLLDGLNQAFEEVSSQNGGAEGQNVHLEQKLYDGVSATSTWLDDVEEHLFVA
TALLPEETETCLYNQETLAKDIKEMSEEMDKNKNLFSQAFPEQGENRDVIEDTLGCLLGR
LSLLDSVVNQRCHQMKERLQQILNFQNDLKVLFTSLADNKYIILQKLADVAEQPAAEQIE
AMQQAEDGLKELDAVIVELKRRGDKLQVDQPSTQELSKLQDMYDELMMTIGSRRSGLNQN
LARKKQYERLLQDLADLSETGQEKMAGGQKMIVSSKEEVQQALDKHKEYFQGLESHMILT
ETLYRKIISFALPKETQFHSELMDQASVVLKRAHKRGVELEYILETWSHLDDDYQELIRQ
LEAVESSIPSVGLVEETEERLTDRIALYMRLKSSLTEYQPKLYQVLDDGKRLLISISCSD
LESQLNKLGEHWLNNTNKVSKELHRLETILKHWTRYQSESAELTRWLQSAMDRLEFWSQQ
SVTFPQELETVRDHLNAFLEFSKEVDAKSSQKSAVLSTGNQLLRLKKVDTAALRSGLSQI
DSQWMELLTHIPVVQEKLHQLQMDKLPSRHAIAEVMSWISLMESVIQQDEENITNIVGYK
AIHEYLQKYKGFKIDINCKQLTVDFVNQSVLQISSQDVESKRSDKTDFAEQLGTMNRRWQ
ILQGLVTEKIQLLEGLLESWTEYDNNVKCLKIWFETQEKRLKEHHRIGDQASVQNTLKDC
QELEELIKAKEKEIEKVEQNGLSLVQNKKEGASAIVINTLGELNHCWANLDHQVAQLKIF
LQSMLDQWGIYKVAYDELNSYLMEARYSLSRFRLLTGSMEAVKVQVENLQGLQDELENQE
NSLQKFGSVTNQLLKECHPPVTETLTNILKEVNMRWSNLLEEITEQLHSSKALFQLWQRY
KDYYKQCASTILQHEDRSNELLKTATNKDIADDEVAIWIQNCNELLKSQKTVQDSLFVLQ
ELGDQLKQQVDSSAASAIQSDRLSLSQRLSALEQALSRQQTMLQKTGVLDYETFSKSLDG
LEAWIVEAEEVLTEQDPSHASDLSAIQDRMEELKGQMLKFSSMVPDLDRLNELGYRLPLS
DKEIKRMQNLNRHWSLISSNTTERFSKLQSFLLQHQTFLEKCETWMEFLIQTEQKLAVEI
SGNFQHLLEQQRAHELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQ
WQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLVEVSYQPVTGLGSVPIPLQQARTL
LDEIQLKEKVLLRQQGSYILTVEAGKQLLLSADSGAEEALQAELTEIQDRWKSASTRLDQ
QKKKLSFLLKDWEKCEKGIADSLEKLRAFKKKLSQPLPDHHDELHIEQMRCKELENAVGG
WTEDLTHLALLKETLSTYISPDDISILSERIELLHRQWEELCHQVSLRRQQVSERLNEWA
VFSEKNKELCEWLTQMESKVSQNGDILIEEMIEKLRKDYQEEIAVAQENKIQLQQMGERL
ARASHESKASEIEYKLGKVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSILRSWLSH
IESELSKPVYETCDSEEIQRKLNEQQELQRDIEKHSTGVASVLNLCEVLLHDCDACATET
ECDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKTAESTAAF
PSSSGVLYTVAKEELKKFEGFQRQVHESLTQLELINKQYRRLARENRTDSSCRLKQMVHE
GNQRWDNLQRRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQA
KIKQLKAFQQEISLNQNKIDQIIVQGEQLIEKSEPMDAAIIEEELDELWRYCQEVFGRVE
RYHKKLIRLPLTDDEPDLSDREMDMDESADLSDLHWPDKSTDNVLSPHPSSNLSLSLAQP
LRSERSGRDTPASVDSIPLEWDHDYDLSRDLESAVSRNLHSEDEEGQDDKEFYIKGAAGL
AGEPSSLETHIRQLDKALDASRLQMQQTENIIRSKTPTGPELDSSYKGYLKLLGECSGSI
DAVKRLGFKLKEEEEKFSGFINLDSTETQTAGKL
Download sequence
Identical sequences 9258.ENSOANP00000024509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]