SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000024576 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000024576
Domain Number 1 Region: 62-153
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.09e-41
Family Small-conductance potassium channel 0.00000323
Further Details:      
 
Domain Number 2 Region: 7-65
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000119
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000024576
Sequence length 247
Comment (Ornithorhynchus anatinus)
Sequence
RYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVV
ARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTKLVKKPDHARVRKHQR
KFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMFDMVSELQERNEDLEKRIVALENK
IDALSASLQALPGLITQAIRQRPAPPPREGGPPRPGPGSHSSEHSAWTPTRRRKSPSTAP
HTSSDSG
Download sequence
Identical sequences 9258.ENSOANP00000024576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]