SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000026437 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000026437
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.57e-21
Family Alpha-macroglobulin receptor domain 0.0000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000026437
Sequence length 97
Comment (Ornithorhynchus anatinus)
Sequence
SYTGSRPASNMVIADVKMVSGFIPLKSSVKMASAPTAASPALRSLTPPRQLTNETLSLTF
TVTQDVLVQNLRPAPVRVYDYYETEPFAVIFSPEPPS
Download sequence
Identical sequences F7G7N6
ENSOANP00000026437 9258.ENSOANP00000026437 ENSOANP00000026437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]