SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000000070 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000000070
Domain Number 1 Region: 415-518
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.02e-26
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 0.00000000000000196
Family Outer arm dynein light chain 1 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000000070
Sequence length 559
Comment (Dasypus novemcinctus)
Sequence
RNQLSSLPPYICQLPLRVLIVSNNKLGALPDIRALGSLRQLDVSSNELQSLPAELCSLTS
LRDLNVRRNHLSTLPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGDPEQIDFIDSHIPG
EEEPDAVQEQRPPESRPVAGGGEQAPSNRREEPAGEERRRPDTLQLWQERERRQQQQSGV
WGVPRKDSFLKLGIRTPGGGAAAPSTQAAYNSTPKSNATQPGASVGQGAPASAPSYQEPL
PLAGSATVSAPRPLGSIQRPNSFLFRSSSQSSSGPSSPDSLLRPRRSPQVLDEKEAMAQL
RQVLESRLQRPLPEDLAEALANGVILCQLANHLRPRSVPFIHVPSPAVPKLSALKSRKNV
ESFLEACRKIGVPEADLCSPSDLLQGTAQGLRTTLEAVKRVEGSAPPPLWPPSGLGGFVL
FYVVLMLLLYVVYTRLQGS
Download sequence
Identical sequences ENSDNOP00000000070 9361.ENSDNOP00000000070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]