SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000000271 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000000271
Domain Number 1 Region: 1001-1047
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000386
Family Calponin-homology domain, CH-domain 0.0066
Further Details:      
 
Weak hits

Sequence:  9361.ENSDNOP00000000271
Domain Number - Region: 531-571
Classification Level Classification E-value
Superfamily BLRF2-like 0.0484
Family BLRF2-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000000271
Sequence length 1049
Comment (Dasypus novemcinctus)
Sequence
MKSAAKPWSPVMKAGSHGADRPRPLPAATSGMKGSKSSTSLAFESRLSKXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAATSTKRTGIPAPRELSVSVSRERA
VPRGPSNPRKSVSSPTPSATPTPTKHLRLTAAKPKQDNDSAEKAVLESQVRELLAEAKAK
DSEINRLRSELKKCRERRAPNSEGPDALVGAAPGSPGGAEPLTRALEEDRKTFQKELADL
QEENRALKEKLMYLEYSPNSEGAASHTGDSSCPTSATQELSLGSPPGNQLSSETEECKNA
RGSALRTSGSSSSDVTKASLSPDASDFEHIAADTPSRPLSSHSNPFKSPRCSTSGSSPNN
ISELSLASLTEKIQKMEENQHSTAEELQATLQELSDQQQMVQELTAENEKLADEKTLLET
SFHQHRERAEQLSQENEKLLSLLQERVKKEEPGAQGGRILELEQKCADTLEQGRFEREKL
LNIQQQLTCSLRKVEEEHQGALERMKQLKEENEKLNGLLERERHSNGVMAKTVEECRATV
DGLKMENGSLKAQLESEKQNVAETSSVGPRAESRELQEMLKAVRAEKDQLELSCSELRQE
LLKANDEIKHVSSLLAKVEKDYSYLKEICDRQAEQLSRTSLKLQEKASENDAEIKDMKET
IFELEDQVEQHRAVKLHNNQLINELEXXXXXXXXXXXXXXXXXXXXXXXXXTKLRPIQAD
IVVAINIKSKAQQELRKKRSLLKKENHERHQKELGDMQGHGRWVTPPASEDAEAAEADAP
GRWHGVYVNRTSPTPPEPAATVKSLIKSFDLGRPGGTGQNISVHKTPRSPLSALPVRTTP
AAAVSPMQRHSTYSHVRPAGKGAAQGLDLPDLPLAXXXXXXXXXXXPDPYLRKSPSLELN
RPPSLGFESTRLLSSSSGGLKPPSKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRNLLLAFEAAESVGIKPSL
ELSEMLYTDRPDWQSVMQYVAQIYKYFET
Download sequence
Identical sequences 9361.ENSDNOP00000000271 ENSDNOP00000000271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]