SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000000850 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000000850
Domain Number 1 Region: 691-970,1010-1030
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.11e-45
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 
Domain Number 2 Region: 2795-2888
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000393
Family Motor proteins 0.033
Further Details:      
 
Domain Number 3 Region: 1605-1694
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000372
Family Motor proteins 0.036
Further Details:      
 
Domain Number 4 Region: 1765-1839
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000292
Family Motor proteins 0.052
Further Details:      
 
Domain Number 5 Region: 1519-1611
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000398
Family Motor proteins 0.033
Further Details:      
 
Domain Number 6 Region: 1841-1919
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000451
Family Motor proteins 0.049
Further Details:      
 
Domain Number 7 Region: 1243-1320
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000673
Family Motor proteins 0.061
Further Details:      
 
Domain Number 8 Region: 1417-1515
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000956
Family Motor proteins 0.068
Further Details:      
 
Domain Number 9 Region: 1698-1763
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000135
Family Motor proteins 0.028
Further Details:      
 
Domain Number 10 Region: 2135-2207
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000138
Family Motor proteins 0.032
Further Details:      
 
Domain Number 11 Region: 2279-2353
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000266
Family Motor proteins 0.04
Further Details:      
 
Domain Number 12 Region: 1918-1998
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000478
Family Motor proteins 0.06
Further Details:      
 
Domain Number 13 Region: 2354-2419
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000743
Family Motor proteins 0.044
Further Details:      
 
Domain Number 14 Region: 2692-2793
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000504
Family Motor proteins 0.04
Further Details:      
 
Domain Number 15 Region: 2209-2282
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000077
Family Motor proteins 0.042
Further Details:      
 
Weak hits

Sequence:  9361.ENSDNOP00000000850
Domain Number - Region: 2058-2130
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000114
Family Motor proteins 0.057
Further Details:      
 
Domain Number - Region: 2522-2623
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000152
Family Motor proteins 0.092
Further Details:      
 
Domain Number - Region: 1985-2058
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000451
Family Motor proteins 0.047
Further Details:      
 
Domain Number - Region: 2884-2973
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00138
Family Motor proteins 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000000850
Sequence length 3381
Comment (Dasypus novemcinctus)
Sequence
PKEKITISVHWTPLTGRRRREIMTFLVNDVLKHQAILLGNAEERKQKKRSLWDTINKKKV
STSSSHDKRISTIQNVNKTFSISPKVNRVRSPLQACENLAMNEGCSPTENNSLILEENSI
PISLSSSHFKECHGDTCLPLSIHQFATYISLHGTENGELLKIEGGNISEDFKEKITTESS
FNSINTNSQIEEKNRLILTPDYSSTLNITGSQGNFLSPDSFVNNSHVANNELELVTCLSS
DKLMNGNSKPMHLESETVHEIYQTILSPDSFVNDNYGLTQDLESESINPILSPSQFVKDN
MAYICTSHETRKFSLSSNENSKGPQSPQDWRKNKVLSCLSKSEGSKSPKAVFQEPKAIEI
KSNYYSFTKQNHPKSAFHHISSYNKQSKRRPILSATVTKRKPMCARENKIETNKPKAKRC
LNSAVDECDKVILDNHKEKAALHSYLPIIDPILSKSKNDKNEITPSSLKIASVARKRKSD
GNLENTNVKAAVTEPMEVQEIKKICFSPVDSKTSTIKKTKRVITPISKCIRNREKLNLKK
KTDSLVHRTPSSKMNRRTKPIVAVARSNLTFIKPLKTXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXIEIEARRLIVRKDRHLWKDVGERQKVLNWLLS
YNPLWLRIGLETIYGELISLEDNSDVTGLAMFILYRLLWNPDIAAEYRHPSVPHLYRDGH
EEALSKFTLKKLLLLVCFLDYAKISRLIDHDPCLFCKDAEFKASKEILLAFSRDFLSGEG
DLSRHLNFLGLPVSHVQTPFDEFDFAVTNLAVDLQCGVRLVRTMELLTQNWTLSKKLRIP
AISRLQKIHNVDIVFQILKSQGIQLIDEQGNTIQSKDIVDRHREKTLALLWKIALAFQVD
ISLNLDQLKEEIDFLKHTQSKKKTASALSCHSDVVINKIKDKRYSASFEKYSESIKLLMD
WVNAVCAFYNKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLMLKRENLEKFQNKSASVIQGHW
RRYSARKRYLKLKYYSIILQSRIRMIIAVSSYKRYLWATVAIQRHWRAYLQKKQDQQRYK
MLKSSCLIIQSVFRDGKHRKMQLQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQKYYKAYRKGKIERIHYLQKR
AAAIQLQNFFRRMKAHNLHRQIRAASVFQSYWRMRRDRLQFLNLKRIVIKLQAHIRKHQQ
LQKYKKIKKAAIIIQTHFRAYISARKVQASYQRTCCAVVILQSAYRGMQARKRFIHILIS
IIKIQSYYRAYISHKKFLKLKKATIKLQSIIKMKRMRKQFLYLREATLYIQRWYRSKKIA
VLKREEYRQLQESCTKLQAFVRGYLVRKQMRLQRKAAILLQSYFRMRKMRQYYLKIYKAT
IIIQEYYRAYKAQVNQRKNLQVNRAITCLQAAYRGYKVRHLIKQQSTAALKIQTAFRGYS
KRMKYQSVLQAIIKIQRWYRACKTAYDIRAHFLKTRAAVISLQSVYRGWKVRKQIRKEHK
AAIKIQSAFRMAKAQKQFKLLKTAALIIQQHLRARTVGQKQHKEYIELCHAALKLQAAWR
RKKMRRRIQRQHKCAVIIQSYYRMYVQQKKWKVMKKATLVIQMYYRAYSIGKKQHHLYLK
TKIATVIVQSAYRSMRVRKKIKECNKAAVTIQSKYKAYKTKKKYATYRASAITIQRWYRD
IKTAHHQYKEYLNLKTAAIKIQAVYRGIRVRRHIQRMHMAATFIKALFKMRHSKIRYHTM
RKAVIIIQVRYRAYCQGKIQREKYLTVLKAINILQASFRGARVRQTLKKSQISATVIQSY
YRMYREQIYFNKLKKAAKIVQQRYRAVKERNIQFQKYNKLRHSVICIQAIFRGMKARRQL
KVMHLAATVIQRRFRTLIMRRRFLSLRKTVLWVQRKYRANVCARHRLQSLQLQKAVIKIQ
SLCRRLIIKKKLQEMHRAAVLIQSAFRMHRAYVRYRALKEASVVIQQQYRANRSAKMHRQ
CYLIQRHSAVLLQAAFRGMKTRRHLKNMHSFATLIQRRFRSLVMKRRFISLKKAAIFVQR
KYRATICAKRCLHRFLQLRKAAITIQSSYRRLVVKKKLKKMHRAAVLIQATFRMHRTYVI
FQTWKHASILIQQYYRTYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLLRERHIAALI
IQSTYRMYRQYSFYQKIRWATKVLQEKYRVNTNKQKALQDYPLKKAAICSLAGFQGKNIK
EQIQREHQAAIIVQKHFKAFKVRRHYLYFRATVIFVQRRYKALTAMQARTQAVICIQSSY
RGFKVRRDIQRLHLAATLIQSFYRMHRAKVVYRAKKTAIVVIQNYYRSYVRKKVERNKFL
AVQKSAWTIQAAFRGMKVRQKLKNTLEKKMAAVNQPAFCSYRTKTQHEAVQSTALMIQKG
YKISLLAGSQKADYHSQRKAAITIQRAFREMVTKKLETQKCAALRIQSYFQMVVCRRRFI
QQRRAAITLQQYFRTWQIRKKFLLYRKAAVVLQNHCRAFLSAKHQRQGFLQIRYSVVIIQ
ARMKGFIQKRKFQKIKNSSLKLQSVWRRYKARKYLCKVKAACKIQAWYRGCRARKEYLGV
LKAVKIIQGCFFTNQERARFLKVRASAVIIQRKWRATLSARIAREHLLMIKRHRAACLIQ
ANFRAYKGRLNFLQQKSAALIIQKYMRARKAGKCERIKYVELKKSIVVLQAIVRGWLVRK
RILEQRAKIRLLRFTAAAYYHLSALRIQRAYKLYMTVKNVNKQINSVICIQRWFRERLQQ
KRFNQKYQSIREIQHKPQEQLSQENRAASVIQKAVRHFLLRKNQEKFNSGIIKIQXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAVQVLLNVAKYEKTTSAVY
DVGNCIDTLLELLQMYREKAGDKVADKGGSIFTKTCCLLAVLLKTTNRASDVRSRSKVVD
RIYSLYKLTSRKHKMNTERILYKQKMNYSRSIPFIPETPVRTRVVSRLKPDWVLRRDNME
EITNPLQAIQMVMDTLGIPYE
Download sequence
Identical sequences 9361.ENSDNOP00000000850 ENSDNOP00000000850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]