SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000001197 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000001197
Domain Number 1 Region: 153-274
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-34
Family Spectrin repeat 0.0000859
Further Details:      
 
Domain Number 2 Region: 459-599
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-29
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 1706-1859
Classification Level Classification E-value
Superfamily Spectrin repeat 3.43e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 4 Region: 283-384
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 5 Region: 1387-1511
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-22
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 6 Region: 596-712
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-21
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 387-494
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-18
Family Spectrin repeat 0.00073
Further Details:      
 
Domain Number 8 Region: 1-112
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.06e-16
Family Calponin-homology domain, CH-domain 0.00015
Further Details:      
 
Domain Number 9 Region: 1087-1231
Classification Level Classification E-value
Superfamily Spectrin repeat 2.61e-16
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 10 Region: 1865-1924
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000605
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 11 Region: 1242-1337
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000484
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 12 Region: 793-852
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000024
Family Spectrin repeat 0.005
Further Details:      
 
Weak hits

Sequence:  9361.ENSDNOP00000001197
Domain Number - Region: 705-744
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00187
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000001197
Sequence length 1970
Comment (Dasypus novemcinctus)
Sequence
NPRLVLDLIWTIILGFQNQDIVVQTQEGRETRSXXXXXXXXXXXXXXXXXXXXXTNFTSS
QVGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDVAERQLGIIPLLDPEXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXGKRVGKVIDHAIETEKMIEKYSGLASDLLTWIEQTI
TVLNSRKFANSLVGVQQQLQAFSTYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYT
PHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKLEQLARRFDRKAAMRETWLNENQ
RLVAQDNFGYDLAAVEAAKKKHEAIETDTSAYEERVRALEDLAQELEKENYHDQKRITAR
KDNILRLWNYLQELLQSRRQRLQMTLALQKLFQDMLHSIDWMDEIKAHLLSAEFGKHLLE
VEDLLQKHKLMEADIAIQGDKVKAITAATLPFTEGKGYQPCDPQVIQERVSHLKQCFAEL
SNMAAGRKAQLEQSKRLLKFFWEMDEAESWIKEKEQIYSSLNYGKDLTSVLILQRKHKAF
EDELRGLDAHLEQIFQEAEGMVTRKQFGHPQIEARVKEVSAQWEQLKELAAFRKKNLQDA
ENFFQFQGDADDLKAWLQDAHRLLPSEDVGQDEGATRALGKKHKDFLEELEESHGVMKHL
EQQAQGFPQEFRDSPDVTNRLQALQELYQEVVAQADLRWQRLQDALDLYTVFGKTDACEL
WMGEKEKWLAEMEIPDTLEDLEVIKHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXWQAFRAVVSEQREAVDSALRVHNYCVDCEETSKWIIDKTKVVESTKD
LGRDLAGVIAIQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXEYTLAHLETPDSFEAAKAAIRKFEEFLMSMENNRD
KVLSPVDSGNKLVADGNLYSDKITEKVQLIEDRHRKNHDKAQEASDLLRDNLELQNFLQN
CQELSLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVAELASHQGWLENVDAXXKQLMEE
KLFITIVSQRLEALHRLDELQATTEEKTQQLSAARSSDRLQTQADLNKWISAMEDQLRSD
DPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELFAQVPSLGEEAGEADLSIEKRFLDLLE
PLGRRKKLLESSRAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQN
EILGHAPRIEDVLQRGHQLVEAAEIDCQDIEERLGYLQGSWDTLREAAAGRLQHLRDANE
AQQYYLDAGEAEAWIGEQEQVISDETPKDEEGALVMLKRHLRQQRTVEDYGRNIKQLAGR
AQSLLSAGHPEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXVQQFQDVAARLQTAYAGEKADAIQNKEQEVSAAWQ
ALLNACAGRRTQLVDTADKFRFFSMARDLLSWMESIIRQIETQERPRDVSSVELLMKYHQ
GIKAEIETRAKNFSACLELGESLLQRQHQASEEITEKLRQVVSRRREMKEKWEARWDRLS
MLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHTVDSVEKLIKRHEAFEKSTASWEERFA
ALKKPTTLELKERQTPDRPAEEPGAQEEEGETAGEAPRGPHRAATERTSP
Download sequence
Identical sequences ENSDNOP00000001197 9361.ENSDNOP00000001197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]