SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000002436 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000002436
Domain Number 1 Region: 22-291
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.96e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 615-754
Classification Level Classification E-value
Superfamily Spectrin repeat 7.32e-32
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 3 Region: 2175-2276
Classification Level Classification E-value
Superfamily PH domain-like 3.7e-29
Family Pleckstrin-homology domain (PH domain) 0.00000322
Further Details:      
 
Domain Number 4 Region: 1023-1178
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-29
Family Spectrin repeat 0.0000216
Further Details:      
 
Domain Number 5 Region: 920-1070
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-26
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 6 Region: 824-963
Classification Level Classification E-value
Superfamily Spectrin repeat 4.13e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 1448-1602
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-25
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 8 Region: 332-428
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-25
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 9 Region: 1854-1997
Classification Level Classification E-value
Superfamily Spectrin repeat 5.01e-23
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 10 Region: 437-540
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-23
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 11 Region: 1695-1798
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 541-649
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-22
Family Spectrin repeat 0.00041
Further Details:      
 
Domain Number 13 Region: 1152-1267
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-21
Family Spectrin repeat 0.0001
Further Details:      
 
Domain Number 14 Region: 758-858
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-20
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 15 Region: 1607-1691
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000336
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 16 Region: 1978-2063
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000144
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 17 Region: 1299-1347
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000445
Family Spectrin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000002436
Sequence length 2276
Comment (Dasypus novemcinctus)
Sequence
GGADVEEQLRFTMTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKAL
ADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRM
RIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETED
NKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKS
NAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGK
RIGKXXXXXXXXXXXXXXXXXXXXXXXXXXXQTIIILNNRKFANSLVGVQQQLQAFNTYR
TVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHEREL
ALRNELIRQEKLEQLARRFDRKAAMRGTWLSENQRLVSQDNFGFDLPAVEAATKKHEAIE
TDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNL
GLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIGIQAERVRGVN
ASAQKFAADGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMA
EEESWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSSHFEQAIKEGEDMIAEE
HFGSEKIRERIVYIREQWANLEQLSAIRKTRLEEASLLHQFQADADDIDAWMLDILKIVS
SNDVGHDEYSTQSLVKKHKDVAEEIANYRPTIDTLHEQAGALPQEHAESPDVRGRLSGIE
ERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKELWLNNMQIPEKLEDLEVIQ
HRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKK
DALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAI
EAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFL
RDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMV
TQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQ
EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQE
KVDSIDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSLWINEKMLTAQDMSYDEARN
LHSKWLKHQAFMAELASNKEWLDKIEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLENQ
MEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIH
QFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERS
QNIVTESGSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEESHKAQQYYFDAAEAEAWM
SEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHERISMRQSKVDKLYAGLKD
LAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFAR
DTGNIGQERVDTVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASY
ELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQE
DAARLQAAYAGDKADDIQKRENEVLEAWKALLDACEGRRVRLVDTGDKFRFFSMVRDLML
WMEDVDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLT
EKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLI
KRHEAFEKSAATWDERFSALERLTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXDTSKGEQVSQNGLPAEQGSPRMAEMVDTSEMVNGAAEQRMSSKESSPIPSPTSDRKA
KTGLPAQSAATLPARTQEMPSAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGF
YKDAKTAASGIPYHSEVPVSLKEAICEVAVDYKKKKHVFKLRLSDGNEYLFQAKDD
Download sequence
Identical sequences ENSDNOP00000002436 9361.ENSDNOP00000002436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]