SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000006174 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000006174
Domain Number 1 Region: 10-51
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000863
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0043
Further Details:      
 
Domain Number 2 Region: 69-119
Classification Level Classification E-value
Superfamily EF-hand 0.00000956
Family Polcalcin 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000006174
Sequence length 128
Comment (Dasypus novemcinctus)
Sequence
MAAAGDRESAARDYLEKHRIMQLLKHLTSTLLFSQPEKPREYLIALLERLRIAKITGVAF
PFFMDNSNIVSMFEMMDTSGKGSISFVQYKEALKTLDLCAAGEVLKDDGHSITLDKFRNE
VNKRTHEI
Download sequence
Identical sequences ENSDNOP00000006174 9361.ENSDNOP00000006174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]