SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000006808 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000006808
Domain Number 1 Region: 266-368
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.01e-19
Family Calponin-homology domain, CH-domain 0.0035
Further Details:      
 
Weak hits

Sequence:  9361.ENSDNOP00000006808
Domain Number - Region: 145-181
Classification Level Classification E-value
Superfamily FlaG-like 0.0628
Family FlaG-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000006808
Sequence length 372
Comment (Dasypus novemcinctus)
Sequence
MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXKLECEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLAPRNIKWNVD
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXTLITFVNKHLNKLNLEVTELETQFADGVYLVLLM
GLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRV
LYNLFTKYRNVE
Download sequence
Identical sequences 9361.ENSDNOP00000006808 ENSDNOP00000006808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]