SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000008939 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000008939
Domain Number 1 Region: 19-77,192-258
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.76e-32
Family Calponin-homology domain, CH-domain 0.00055
Further Details:      
 
Domain Number 2 Region: 8031-8186
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-22
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 4490-4647
Classification Level Classification E-value
Superfamily Spectrin repeat 3.26e-18
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 6950-7092
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-18
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 5 Region: 5029-5188
Classification Level Classification E-value
Superfamily Spectrin repeat 3.96e-17
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 6 Region: 7403-7534
Classification Level Classification E-value
Superfamily Spectrin repeat 4.92e-17
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 7 Region: 7076-7206
Classification Level Classification E-value
Superfamily Spectrin repeat 1.73e-16
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 8 Region: 1624-1758
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000012
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 9 Region: 6737-6879
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000336
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 10 Region: 1405-1540
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000249
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 11 Region: 4272-4428
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000903
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 12 Region: 3871-3974
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000619
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 13 Region: 7330-7437
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000772
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 14 Region: 5903-6047
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000156
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 15 Region: 8486-8633
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000347
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 16 Region: 559-698
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000504
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 17 Region: 3744-3866
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000926
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 18 Region: 2460-2577
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000115
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number 19 Region: 1713-1865
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000023
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 20 Region: 7601-7743
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000531
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 21 Region: 4938-5039
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000993
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 22 Region: 5157-5266
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000259
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 23 Region: 1516-1620
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000432
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 24 Region: 4859-4970
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000929
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 25 Region: 1977-2088
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000537
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 26 Region: 4187-4317
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000756
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 27 Region: 2625-2717
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000874
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 28 Region: 6534-6660
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000101
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 884-1014
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000222
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 30 Region: 3984-4116
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000259
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 31 Region: 7797-7850
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000288
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 32 Region: 3254-3306,3625-3687
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000647
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  9361.ENSDNOP00000008939
Domain Number - Region: 7907-7967
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000446
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 5271-5361
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00249
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 1087-1157
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00317
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 4686-4761
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00822
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 6189-6293
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0677
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number - Region: 788-921
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0719
Family Spectrin repeat 0.023
Further Details:      
 
Domain Number - Region: 6357-6437
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0864
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000008939
Sequence length 8693
Comment (Dasypus novemcinctus)
Sequence
MAVSRTASRSPRDIAVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMAVEDLFEDMKDGV
KLLALLEVLSGQKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXQVGLEVKDFGRSWRSGVAFHSIIQAIRPELVDLEKVKGRSNRENLEE
AFTIAETELGIPRLLDPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKSLPAPLGTIGAWLYRA
EVALREEITIQQAHEETANTIQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPDQ
LEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRDSVELLLQ
NYISFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAESVMKFMSETTTQWRNLSVEV
RSVRSMLEEVISNWDRYGATVGSLQAWLEDAEKMLSQSEHAKKDFQDLPHWIQQHSSMND
AGNFLIETCDEIVSWDLKQQLLLLNGRWRELFMEVKQYARADEMDRMKKEYAEFVTTLSA
FTTEAHRKLSEPLDVSFINVKLLIQDLEDIEQRVPIMDAQYKMITKTAHLITKESSQEEA
NEMFATMSGLKEQLTKVKECYPPLLYESQQLSVPLEELEKQMTFFYDSLGKINEILTVLE
HEAQSSALFKQKHQELLTCQESCKKTLALIEKGSQNVQKFVTLSNVLKHFDQTKLQRQMA
DVHVAFQNMVKKTGDWKKHVETNSRLMKKFEESRAELEKVLKMAQEGLEEKGEPENLLKR
HTEFFSQLDQRVLNAFLKACDELTDILPEQEQQGLQEAVRKLHKQWKDLQGEAPYHLLHL
KIEVEKNRFLASIEECRTELDREAKLVAQEGSEKMLKEHRVFFSDKGPHHLCEKRLQLIE
ELCLKLPVRDPMRDTPDACHAALKELRAAIDGAHRRLREDPDKWRDYTSRFSEFSSWIAA
KETQLKGIKEDVMDPSSHGEVKQAVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XDFSKRTGGIAVQAENLVKEASEIPLGPKNKQLLQQQAKSIKEQVKKLEDTLEEDIKTME
MVKNKWDHFGNNFETLSVWITEKEKELNALETSSSALDMQINQIKIATQEIESKISSITG
LEEEAQSFAQFVTTGESARIKAKLTQIRRYWEELRDNAQCLEGTILGHLSQQQKFEENLK
KIQQSVSEFEDKLAEPVKICSSATETYKVLQEHMDLCQALEGLSSTVSAFSASAHKVANR
DSSVQEATALQQQFEGTLSRARERQTALELLEHWQRLEKELLAFLTWLERCEAIASSPEV
GVSADRVKVEGELQTIQALQSEVVSQASSYSSLLRLKESLFSAASKDDVKAVKLHLEQLD
ERWTVLPQMISKRISFLQSVVAEHQQFDEQLLSFSVWIKLFLSELQSSSEISVTDHAAAL
TRHKDHAEEVESQKAEVQNLQGRLAKLCSLGRAEDLPLLQGKAEDCFQLFEEASQVVGRR
QLALSQLAEFLQSHAALSGALRRLRQTVEATKSMSKKQSDLLEKDLSIAVQDAKALESTA
VGLDGFLAKAQYHLKGGSSEQRASCRALADQLCLELEGIQNLLGTKQSEADALAALKKAF
HDQKEELLRSVEDIEERTDRERLKEPTRQALQQRLRAFNQLEDELNSHEHELSWLKDKAK
QIAQKDVAFAPEVDREIHCLEVTWEDTKKLIHENQGQCCGLIDLMREYQNLKSAVTKVLE
NTSSVIVTRTTIKDQEDLKWALSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXVSERIEENMDRLRVSLTIWDDVLSSKEEIEGWSNSAVPQLSES
ISNLSDSRQMEEFLKEFESDVKNKALQLEELHSKVSDLKELTKNPETPPDLXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTILDSVGDGQSK
LDAVTQEGQTLFAHLPKQIVSSIQEQVTQANEEFQAFLKQCLKDKQALQDCALELGSFED
QHRKLNLWIHEMEERLSTENLGESKQHIPEKKNEVHKVEMFLGELLAAXXXXDKLSQRQL
LSEEHGAGKKGLCAQLLASYQSLLRLTKEKLPSCQVALQEHEVLEEALQGLWSWLRDVQD
RVACAESTTGSRGTLEKRLLQVQDILLLKGEGEVKLNMAIGKGEQALRSSSKEGQKVIQT
QLQTLKDVWANVMSSSVRAQXXXXXXXXXXXXXXXRKSQLEKSMESVDRKVEHPLQPQSG
LKEKFSLLEFFLNLVLGRELYAKTGDDTFQEAAQEELKVQFHDITTVAKXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELRDSRALGAGRLDRV
ERLAPAVKQHSTAGGGQLLDNEMQALRADWKQWEAGLFQAQSGLEDRVSQMTLSEQEFSG
QVARLEQALEQFGDLLEGWARQLVVPAGESTDRELAECWHRGKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXEKVSRLDRIVAEHHQFSLGIKELQDWMADAVHMLESYCHPTSDKAVLDSRM
LKLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXKWHEEITACRDEVEEVGVGAQEILDERHVSSPVCCQAT
QLTARFQALLLQVLEQMKSLEEEIQSLEESESSLSSYADWYSSTHNNFKNVASKIDKVDR
ALMGKKKKALEVLLKDMEKGHSLLKSAREKGERALKFLQGDEAEALRTEILDHVERLKEL
TSTVRREHLTLEKGLQLAKEFSDKYKAQTQWVAEHREILRVPEEPKMELYEKKAQLSKYK
SLQQTVLSHEPSVKSVSEKGEALLELVQDATLKDKIGQLHTDYQELCNSGKEHVLRLEAK
VKDHEDYNSELQEVEKWLLQMSGRLVAPDLMELSSLETITQQLARHKAMMEEIAGFEDRL
SDLQLKGDKLVHQCADRFQARLKQNVHAHLQGTRDSYSAICSTAQRVYQSLEHELQKHVS
RQDTLQQCQAWLSAVQPDLKPSPPPPLSRAEAVKQVKHFRTLQEQARTYLDLLCSMCDLS
NSSVKTTAKDIQQTEQMIEQRLVQAQNLTQDWEEIKHLKAELWISLQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXDFVNKLQSKQASVTAITEKVNKLTKNQESPEHKEISHLNDQWSD
LCCQSNELCLQREEDLQRARDYHGCMNVIEVFLEKFTTEWDSLARADAESTAVHLQALKK
LALALQEKKYAVEELKDQKQKMIEHLNLDDKELVKEQTRHFEQRWIQLEDLVKTKIQASV
TNLEELTVVQSRFQELMEWAEEQQPGLVQALQQSPPPDMAQNLLMDHLAICSELEAKQVL
LKSLTKDADRVMADLGLQERQLIQKALSDAQGHVNCLSDLVGQRRKYLNKALSEKTQFLV
AVFQATSQIQQHERKMMFREHICLLPDDVSKQVKTCKSVQASLKTYQNEVTGLWAQGRDL
AKGVPEQEKSEVLGKLQELQSVYDTVLQTCGHRLQELEKSLVSRKHFKEDFDKACHWLKQ
ADIVTFPEINLMNESKELHAQLAKYQHILEESPEYENLLLTLQRTGQAILPSLNEVDHSY
LKEKLSSLPQQFNVIVALAKDKFYKVQEAILARKEYTSLIELTAQSLSELEDRFLKMRTI
PSELVAEEALSLRDDCRALLGEVASLGEAVDELKQKKESFRSTGQPWHPDRMLHLVTLYH
RLKRQTEQRVSFLEDTASAYQEHEKMCQQLQKQLEAVRREQTNVNEETLPAEEKLRIYHS
LAGSLQDSGILLKRLTGHLEELSAHLDPLASEKAQHQVQGWQEELEGLTSAIGETVTECE
SRMVQSIDFQTEVSRVLDWLRRVKGELAGPVCLELDLQDIQEQIRKVQIHQEEVQSSLRI
MNALSNKEKEKFTKAKELPSADLEHTLAELSQIDGEVQEALRTRQATLTEIYSRCQRYYQ
VFQAANDWLEDAQGMLQLAASGLDVESLEENLKRHVEFFSAEDQFCSNLEELQGLGSTLD
PLITPTGKEALTQKRASLGKRSQRIIQDSHAQLELLQRCAAQWQDYQKARGEVIDLMNDA
EKKLSAFSLSKASSSREAEGKLSEHKALVSVINSFREKVAALEEKASPLEKDGNDASKAT
ISRSTTTVWQRWTRLRAVAEDQEKILEDAVDEWKGFNEKVKKATEMVGQLQAKVPESSAE
KASKAELLTLLEHHDTFTLELEQQQSALGMLRQQALSMLQDGGAPAAPGEEPTAIEEIAA
VQDRCLNMQERVKSNMKLVKQELKEREVVETQLSSVKSWVQETREYLGNPTIEIDAQLEE
FQILLTEATSHRQKVEKMAEAQKNKYLGLSTILPAELSLQLAEVALDLGTTHDQIDRKEV
EQSKAVSELSQIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAAFHLEEYNEMLEFVLKW
IEKAKVLVHGDIAWNSASQLREQYISHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIAYYQAL
SAERLQKGASRLHASPSTYQELYEPELEPSATAKLDDLQRSWETLKNVISEKQRSLYEAL
ERQQKYQDALQSISSKMEAVEMRLNETLEPGRSPESQMAEHQALMDEILMLQDEINELQS
SLADELVSRSLASDPTDQLALQSTLTVLAERMSTIKMKASGKQQLLEXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYMLVEIEQKVMALSE
LSVHNESLLLEGKTHTKDEAEQLAGKLRTLKGSLLELQRALHDKQLTIQGVAPEKEESSA
DPMTSQVPDVQEWLAQARSSRTHRRQSSLQQQKELEQELAEQKSLLRSVASRGEEILTQH
SAAETSSVGEKPDVLSQELGMEGEKASAEDQMRMKWESLHQEFSTKQKLLQNVLEQEQEQ
VXXXXXXXXXXXXXXXXXXXXXXXXXAVSLLAGLNQAFEEASSQGGGTKNQNIHLEQKLY
DGVSATSTWLDDVEERLFVATALLPEETETCIFHQETLAKDIKEMSEEMDKNKNLFSQAF
PENGENRDVIEDTLGCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDLKVLFTSLADSK
YIVLQKLANVFEQPIAEQIQAIQQAEDGLKELDAGIVELKKRGDKLQVEQPSLQDLSKLQ
DMYDELMMTIGSRRSCLNQNLVLKGQYERARQDLVDLLDTGQEKMAEDQRIIVSSKEEIQ
QLLEKHKEYFQGLESHMILTETLFRKIISFAVQKETQFHTELMAQASAVLKRAHKRGVEL
EYILEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLKSSLDEYQP
KLYQVLDDGKRLLISISCSDLESQLNQLGEHWLNNTNKVSKELHRLETILKHWTRFQSES
ADLTHWLQSAKERLGFWTQQSVTVPQELEMVRDHLNAFLEFSKEVDAKSSLKSSVLSTGN
QLLRLKKVDTAALRSELSHLDGQWTELLTNIPVVQEKLHQLQMDKLPSRHAIVELMSWIS
LMENVIQMDEEEIKNAIGYKAIHEYLQKYKGFKIDINCKQLTVDFVNQSVLQISSQDVES
KRSDKTDFAEQLGAMNRSWQILQGLVTEKIQLLEGLLESWSEYENNVQCLKTWFETQEKR
LKQQHRVGDQASVQTAMKDCQDLEDLIKAKEKEVEKIEQSGLALIQNKKEEVSGIVRCTL
QELNQTWAHLDHMVGQLKMLLKSVLDRWSSYRGAFEEINCQLMDARYSLSRFRRLTGSLE
AVQVQVDSLQSLQDDLEKQEGSLHKFGSVTSQLLKECHPPVTETLSNTLKEVNMRWDNLL
EEVAEQLHASQALLQLWQRYQDYSTQCATAVQRQAARANELLKAATGRDIGDDEVATWSQ
DCNELLRGLATAKDSLFVLHELGEQLKQQVEASAACAIHSDHVSLSQRLCDLEQALCKQQ
SALQAGVLDYEAFAKSLDTLEAWIVEAEETLREQDPSHSSDLSSIQDRMEELKGQMLKFS
SMVPDLDRLNELGYRLPLNDKEIKRMQHLNRRWSLISSQATERFSKLQSFLLQHQTFLEK
CETWMEFLVQTEQKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIVMDGQRLLEQ
GQVDDRDEFNLKLTLLGNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLVEVSH
VPAHGLGSTPIPLQQARTLLDEVQFKEKVFLRQQGSYILTVEAGKQLLLSADSGAEAALQ
TELTEIQEKWKSASLHLEEQRKKLAFLLRDWEACEKGIADSLEKLRTFKKKLSQPLPEHH
EELHAEQMRCKELENAVGSWTEDLAQLTMLKDTLSAFISADDISILDERTELLQRQWEEL
CHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYQE
EIAVAQENKIQLQQMGERLAKASHESKASEIEYKLGKVSERWQHLLDLIAAXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELQRDIEKHSTGVA
SVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFQRQVHESLTQLELINKQYR
RLARENRTDSAGSLRQMVHEGNQRWDNLQKRVTSILRRLKHFIGQREEFETARDSILVWL
TEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISLNHNKIEQIIAQGEQLIEKSEPLDAAV
IEEELDELRRYCQEVFGRVERYHKKLIRLPLADDEHDLSDRELELDDPAALAALRWPEPS
ADSVLSPLPSSNPSLSLAQPLLSQRSGRDTPASVDSIPLEWDHDYDLSRDLETAAPGAPA
SEDEEGQGDTGFYLGGAVGLSGDTGALESQMRQLDRALHDSRFRMQQTEKIIRSKTPTGP
ELDSSYKGYMKLLGECSDSIDSVKRLEHKLKEEEENFPGFVNLNSPETQTAXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXELQRAVDHRKAIILSINLCSSEFTRAGSEESQGLQDRLSQLNGRWDHVCALLEEWRGL
LQDALMQCQDFHEMSHGLLLMLENIDRRKNEIVPIDSHLDAEILQDHHKQLTQIRRELLE
SQLKVASLQDMSCQLLVNTEGTDCLEAKEKVHVIGNRLKLLLKEVSRHIKDLDKLLDMSG
SQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRGKCSLSQPGPSANSPHS
Download sequence
Identical sequences ENSDNOP00000008939 9361.ENSDNOP00000008939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]