SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000008986 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000008986
Domain Number 1 Region: 1391-1528
Classification Level Classification E-value
Superfamily PRC-barrel domain 3.45e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000237
Further Details:      
 
Domain Number 2 Region: 179-284
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000267
Family Calponin-homology domain, CH-domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000008986
Sequence length 1529
Comment (Dasypus novemcinctus)
Sequence
NIPEDLRDPFYVDQYEQEHIKPPVLRLLLSSELYCRVCSLILKGDQAAALQGHQSVIQAL
SRKGIYVMESDDTPVTEPDLSCAPIKMSPHMAMIDALMMAYTVGMISIEKVVASVKRFST
FSASKELPYDLEDAMVFWINKVNLKMRDITEKEVKLKQQLLESPAHQKVRYRREHLSNRQ
LPHFPLLEDLMRDGSDGAALLAVIHYYCPEQMKLDDICLKEVTSMADSLYNIRLLREFSN
EYLNRCFYLTLEDMLYAPLVLKPNLMVFIAELFWWFENVKPDFVQPRDVQEPKDXXXXXX
QKSSRPPPINATRSFMTSPAAPSLAGQPPTQPPAESCPRYYLHPEEPERPGKGASAFSPA
HPLLPLRQKQKPQGEDSPDQRHRSNSLTQVDGQPRGAAVAWPEKKSXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFAERKLQRLNSYETKSSTSSSQKT
TPDASESCPAPLTTWKQKREQSPGRQSQDHASLLASELVQLHMQLEEKRRAIEAQKKKME
ALSARQRLRLGKAAFLHVVKKGKAAAPQTLKPEHFAEEYSQHNGEGFDDGVSKTEVFLVR
EEGELLNESHDVEKESLAFVPQHTPKDLASFHDLEKNKMISAALLDDGVGELVDVSECDL
SIEKLNETISTLQQAILKISQQQEQLLMKPPALPAPGPRSTSQDQKAKAPATSVEPLSPT
GGAGRRPPRLGQGDARSGWPAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXDEQKAEDELAKKRAAFLLKQQRKAEEARARKQQLEAEVELKRDEARRKAE
EDRIRKEKRRELIKQEYLRRKQQQILEEQGLGKPRAKPRKPRPKSAHREESCSDSGTRGS
STPDNLSRAQSGSSLSLASAATTEPESVHSESSPSQRVESLEALPVLSRNPSRSTDRDWE
TASAASSLASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKC
DANHYIILFRDAGCQFRALYCYYPDAEEICKLTGTGPKSVTRKMIDKLYKYSSDRKQFSL
IPAKTMSVSVDALTIHNHLWQPRRPAAPR
Download sequence
Identical sequences ENSDNOP00000008986 9361.ENSDNOP00000008986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]