SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000009762 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000009762
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-87
Family Calponin-homology domain, CH-domain 0.00000164
Further Details:      
 
Domain Number 2 Region: 245-366
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-33
Family Spectrin repeat 0.0000609
Further Details:      
 
Domain Number 3 Region: 854-1009
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-29
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 961-1115
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-27
Family Spectrin repeat 0.0000358
Further Details:      
 
Domain Number 5 Region: 1173-1326
Classification Level Classification E-value
Superfamily Spectrin repeat 1.15e-25
Family Spectrin repeat 0.00071
Further Details:      
 
Domain Number 6 Region: 644-760
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-24
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 7 Region: 1509-1639
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-23
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 1643-1747
Classification Level Classification E-value
Superfamily Spectrin repeat 7.8e-21
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 9 Region: 1429-1541
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-20
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 10 Region: 1328-1440
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-20
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 11 Region: 552-640
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-17
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 12 Region: 1962-2023
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000017
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 13 Region: 2247-2279
Classification Level Classification E-value
Superfamily PH domain-like 0.00000688
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 
Domain Number 14 Region: 1749-1802
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000691
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000009762
Sequence length 2337
Comment (Dasypus novemcinctus)
Sequence
EREAVQKKTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPTKGRMRI
HCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNK
EKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNA
HYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRI
GKVLDHAVEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTV
EKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELAL
RTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXTQDLGKPLAGVEDLLQLHELVEADIAAQAERVRAVSV
SALRFDPEKEYKPCDPQLVSERVAALERSYEALCELAAARRARLEESRRLWRFLWEVGEA
EAWVREQQHLLASADTGRDLTGVLRLLNKHAALRGEMSGRLGPLRLTLEQGRQLVAEGHP
GAGQAAARTAELQAQWERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSP
ELGHDEFSTQALARQHRALEEEIRGHRPTLDALREQAAALPPALSRTAEVQGRVPTLERH
YEELQAQAGGRAQALEAALALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQR
FETLEPEMNALAARITAVNGIAEQLLQASPPSKESIVDTQKQLNHRWQQFRSLADGKKAA
LTSALSIQNYHLECTETQAWMREKTQVIESTQGLGNDLAGVLALQRKLAGTKRDLEAIAA
RVGELTREANALAAGHPAQAPAIDARLREVQAGWDDLRATMRRREESLGEARRLQDFLRS
LDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQGEYSRLRTLGEEVTR
DQADPQCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEY
VLSHTEMPGTLQAADAAIKKLEDFMNTMDASGERIRGLLEAGRQLVSQGNIHAEKIQEKA
DSIERRHRKNQESVQQLLGRLRDNREQQHFLQDCHELKLWIDEKMLTAQDVSYDEARNLH
TKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLGDLHKRWDELETTTQ
AKARSLFDANRAELFAQSCSALQSWLESLQAQLHSDDYGKDLTSVNILLKKQQMLEREMA
VREKEVEAIQTQAKALAQEDRGAGEVERTSRAVEEKFRALCQPMQERCQRLQASREQHQF
HRDVEDEILWVTERLPMASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADLMERQRA
LGPAAAGPELAELQAMWKRLSHELELRGRRLEAALRAQQFYRDAAEAEAWMGEQELHMMG
QEKAKDEPSAQAEVKKHQVLEQALASYAQTIHQLAASSQDMIDHDHPESTRLSIRQAQVD
KLYASLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLR
DKFREFSRDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDGLNEAWADLLELLDTR
GQVLAAAHELQRFLHGARQALARVQHKQQQLPDGAGRDLNAAEALQRRHCAYEHDIQALS
AQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVLVFGRDAGMAEAWLCSQE
PLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFSALEKLTALEEQEKERKRKREEEE
RRRQPPAPAPTASLPAGAPVDGQVAPDAAREGTHPRPPSSTQPPTVNGICPEAESPQPLL
EQQRLEQGSFPERPGSGAGDEAHGPRGEKQPRTRGPAPPAVPQSRSSEPAXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSA
SGEPDEPAVPSASRGMTRAMTMPPVSPVGAEGPVVLRSKDGREREREKRFSFFKKSK
Download sequence
Identical sequences 9361.ENSDNOP00000009762 ENSDNOP00000009762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]