SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000010694 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000010694
Domain Number 1 Region: 46-238
Classification Level Classification E-value
Superfamily vWA-like 7.37e-57
Family Integrin A (or I) domain 0.00024
Further Details:      
 
Domain Number 2 Region: 528-648
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000105
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 3 Region: 365-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000345
Family EGF-type module 0.043
Further Details:      
 
Domain Number 4 Region: 242-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000952
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 443-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000918
Family EGF-type module 0.016
Further Details:      
 
Domain Number 6 Region: 912-955
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000209
Family Chicken cartilage matrix protein 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000010694
Sequence length 958
Comment (Dasypus novemcinctus)
Sequence
MEKMLVSCFLLIFGQILLLPAGARERLHSRSTSRGRHARTHPQTALLGSSCENKRADLVF
IIDSSRSVNTHDYAKVKEFIMDILQFLDIGPDVTRVGLLQYGSTVKNEFSLKTFKRKSEV
ERAIKRMRHLSTGTMTGLAIQYALNIAFSEAEGARPLRENVPRVIMIVTDGRPQDSVAEV
AAKARDTGILIFAIGVGQVDLNTLKAIGSEPHEDHVFLVASFSQMESLTSVFQNKLCTVH
MCSVVEHNCAHFCINTPGSYICRCKQGYILNSDQTTCRXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XIDYCATPNHGCQHECVNTGDSYSCHCLKGFTLNPDGKTCRRINYCALSRPGCEHECINT
EESYYXXXXXXXXXXXXXXXXXXVNHCAENDHGCEQLCLNTEESFVCQCSEGFVINEDLK
TCSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDSCALGNHGCEHSC
VSSEDSFVCQCLEGFILREDGKTCRRKDVCQAVDHGCEHICVNSDESYVCKCLQGFQLLQ
DGKRCRRKDVCKSTRHGCEHTCVNNGHSYICKCSQGYVLAEDGRRCKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLED
SNGSQDSPARELPKMVQPPTESKPVTINIQDLLSCSNFAVQHRYLFEDDTLSRSTQKLYH
STKPSGSPLEEKHDQCKCENLIMFQNLANEEVRKLTQRYLLEEMTQRMEALENRLRYR
Download sequence
Identical sequences 9361.ENSDNOP00000010694 ENSDNOP00000010694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]