SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000011106 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000011106
Domain Number 1 Region: 366-486,515-596
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-52
Family Calponin-homology domain, CH-domain 0.0000232
Further Details:      
 
Domain Number 2 Region: 96-165
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.2e-24
Family Calponin-homology domain, CH-domain 0.0000309
Further Details:      
 
Domain Number 3 Region: 2-70
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000285
Family Calmodulin-like 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000011106
Sequence length 604
Comment (Dasypus novemcinctus)
Sequence
IDHSGYVSDYELQDLFKEASLPLPGYKVREIVEKILVVADNNKDGKISFEEFVSLMQELK
SKDISKTFRKIINKREGITAIGGTSAISSEGTQHSYSEEEKVAFVNWINKALENDPDCKH
LLPMNPSDGSLFKSLADGVLLCKMINLSEPDTIDERAINKKKLTPFTISXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSRAYFHLLYVSPKGEDDGPAXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXESKEERTFRNWMNSLGVNPYINHLYSDLADASVIFQLYEMIRVPVNWSHVNK
PPYPALGGNMKKIENCNYAVELGKNEAKFSLVGIAGQDLNEGNSTLTLALVWQLMRXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKSISTSLPVLDLIDAIAPNAV
RQEMIKRENLSDEDKLNNAKYALSVARKIGARIYALPDDLVEVKPKMVMTVFACLMGKGL
NRIK
Download sequence
Identical sequences ENSDNOP00000011106 9361.ENSDNOP00000011106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]