SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000011828 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000011828
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.86e-43
Family Calponin-homology domain, CH-domain 0.000000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000011828
Sequence length 201
Comment (Dasypus novemcinctus)
Sequence
MANKGPAYGMSREVQSKIEKKYDEELEERLVEWIIVQCGADVGRPDRGRLGFQVWLKNGV
ILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAENYGVTRTDMFQTVDLFEG
KDLAAVQRTLMALGSLAVTKNDGQYRGDPNWFMKKAQEHKREFTDSQLQEGKHVIGLQMG
SNRGATQAGMTGYGRPRQIIS
Download sequence
Identical sequences 9361.ENSDNOP00000011828 XP_004452292.1.11602 ENSDNOP00000011828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]