SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000012038 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000012038
Domain Number 1 Region: 103-147
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000262
Family Elafin-like 0.0013
Further Details:      
 
Domain Number 2 Region: 1-46
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000549
Family Elafin-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000012038
Sequence length 149
Comment (Dasypus novemcinctus)
Sequence
KPGECPKERVTCTHQGLDLCKTDFNCKNYLKCCAFGCRKICLDPFKXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTGQCPLFPFKNRMECP
DSCKSDYDCPDTEKCCESKCGFVCAMAWA
Download sequence
Identical sequences ENSDNOP00000012038 9361.ENSDNOP00000012038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]