SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000013879 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000013879
Domain Number 1 Region: 202-323
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.59e-33
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000013879
Sequence length 326
Comment (Dasypus novemcinctus)
Sequence
SVEQEEAGELEMRRTSDSVILENGHQPGAGPGDGLPEATQTFPAPEPPKPRPMSLSLRLP
HQPVTAVTRISERFSGETSAAALSPTSAAILGGLSSSPSEATTPWTASLSEKNSSFSRPL
SSCGLGAVMAGRRKDSPPLATPPQSPLSPQPAVTQAPHQGERRRELVRSQTLPRTSGAQA
RKALFEKWEQDTAGKGKGEARAKLKRSQSFGVASASSIILILLEWCRSKTLGYQHVDLQN
FSSSWSDGMAFCALVHSFFPDAFDYSALSPTQRQKNFELAFTMAEKLASCERLIEVEDMM
VMGRKPDPMCVFTYVQSLYNHLRRFE
Download sequence
Identical sequences 9361.ENSDNOP00000013879 ENSDNOP00000013879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]