SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000014250 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000014250
Domain Number 1 Region: 955-1082,1114-1319
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.49e-71
Family p120GAP domain-like 0.0003
Further Details:      
 
Domain Number 2 Region: 26-189
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.12e-20
Family Calponin-homology domain, CH-domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000014250
Sequence length 1367
Comment (Dasypus novemcinctus)
Sequence
MERRGAGRGPAAYERLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEACLTMELPSPVELEE
SLRNGVLLAKLGHRFAPSVVPLKKIYDVEQLRYQATGLHFRHTDNINFWLSAVAHIGLPS
XXXXXXXXXXXXXXXXXXXXXXXXXXLFLFRLGLAPQIHDLYGKVKFTAEELSNMASELA
KYGLQLPAFSKIGGILANELSVDEATVHAAVLAINEAVERGVVEDTLAALQNPSALLGNL
REPLAAIYQELLAQAKMEKAANARNHDAGESQDIYDRYLTQAEIQGNINHVNVHGALEVV
DDALERQSPEALLKALQDPALALQGVRRDFADWYLEQLSSDREQKAQELGLVELLEKEEI
QAGVAAANIKGDQEQAMLQAVQRINDAIQRGVAADTVKELMCPEAQLPPVYPFASAIYQQ
ELSVLQRQQQGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXYFNALVKLRQTRGADGALLSWNELQATVSQVNAQVQEEADQVLAVSLINEALDQGS
PEKTLTALLLPAASLDLVSLPVAPRYHLLLVAAKRQKAKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXSHDMKDGTAYYFHLQTFQETEQPPGCHLNTSHVTREEIQAAVTKVTA
AYDRHQLWKANIGFVIQLQARFRGFLVRQKFAERSHFLRTWLPAIIRIQXXXXXXXXXXX
XXXXXXXXXXXXXXXXXIQAWARMWAARRRYWRRLRYFQENANSIVKIQAFFRARRARGD
YRMLVHAPHPPLSVVRRFAHLLNQSQQDFLAEAELLKLQEEVVRKIRSNQQLEQDLNLMD
IKIGLLVKNRITLQEVVSHCKKLTKKNKEQLSDMMVLDKQKGLKSLSKEKRQKLEAYQHL
FYLLQTQPIYLAKLIFQMPQNKTTKFMESVIFTLYSYASNRREAYLLLQLFKTALQEEIK
SKVEQPQDVVTGNPTVVRLVVRFYRNGRGQSALREILGKVIQDVLEDKMLTVHTDPVHLY
KSWINQTEAQTGQRSHLPYDVTPEQALSHPEVQRRLDISIRNLLAMTEKFLVAIISSVDQ
IPYGMRYVAKVLRTTLAEKFPDATESEVYKVVGNLLYYRFLNPAIVAPDAFDIVAVAAGG
ALAPAQRHALGAVAQLLQHAAAGKALSGENQHLRVLNDYLEETHLKFRKFICRACQVPEP
EERFAMDEYSDMVAVAKPVVYITVGELTNTHRLLLEHQDWIAPDHHDPLHELLEDLGELP
TVPDLIGENLAADGNVDLSKLEVSTLTNKFEGLETDSDDSNARNLLL
Download sequence
Identical sequences 9361.ENSDNOP00000014250 ENSDNOP00000014250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]