SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000015259 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9361.ENSDNOP00000015259
Domain Number - Region: 143-175
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0763
Family Calponin-homology domain, CH-domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000015259
Sequence length 198
Comment (Dasypus novemcinctus)
Sequence
MHLQNESGKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKE
YTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVD
YTFDRNVLSRLLNECRELLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKP
HLQKLCDGINKMLDEENI
Download sequence
Identical sequences 9361.ENSDNOP00000015259 ENSDNOP00000015259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]