SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 94122.Shewana3_3024 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  94122.Shewana3_3024
Domain Number 1 Region: 3-70
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000135
Family RecO N-terminal domain-like 0.02
Further Details:      
 
Weak hits

Sequence:  94122.Shewana3_3024
Domain Number - Region: 82-147
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.00256
Family RecO C-terminal domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 94122.Shewana3_3024
Sequence length 233
Comment (Shewanella ANA-3)
Sequence
MKRGYVLHHRPYRESSALVNLLVDGIGRVDAVARVGSGKRSIKSILQPFQPLIFEFSGKS
ELKNISQIEAAAPAVPLSGYSLYAGMYINELLMRILSVHHNAEALFLIYHQALVGLAAQF
CESKLRYLELALLRELGAMPSLIRDTQGEPLIPEHYYQLVPELGFQFVLNSRAKHTYQGA
MLTALNDNQLLQEQFLEAKRLMRSMLQPLLGNKPLVSRQLFIQATASNRDGNN
Download sequence
Identical sequences A0KZN0
94122.Shewana3_3024 WP_011717871.1.57664 gi|117921463|ref|YP_870655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]