SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000000917 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000000917
Domain Number 1 Region: 2-83,117-224
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.92e-59
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000000917
Sequence length 934
Comment (Macaca mulatta)
Sequence
MALLEVLSGRNLLHEYKSSSHRIFRLNNIAKALKFLEDSNVKLVSIDAAEIADGNPSLVL
GLIWNIILFFQIKELTGNLSRNSPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRK
AIKALLAWVQRKTRKYGVAVQDFAGSWRSGLAFLAVIKAIDPSLVDMKQALENSTRENLE
KAFSIAQDALHIPRLLEPEDIMVDTPDEQSIVTYVAQFLERFPELEAEDVFDSDKEVPIE
STFVRIKETPSEQESKVFVLTENGERTYTVNHESSHPPPSKVFVCDKPESMKEFRLDGVS
SRALSDSSTEFMHQIIDQVLQGGPGKTSDISEPSPESSILSSRKESGRSNSLPIKKTVHF
ETDTYRDPSCSKNLSLCFEGSPRAAKESLRQDGHVLAVEVAAEKEQKQESLKIPESSSDK
VPGDLFLAEGTINNSQSSSYNGALESTARHDEESHSLSPPGEDTVMADSFEIKVNLMTVE
ALEEGDYFEAIPLKASKFNSDLVDFASTSQAFNEVPSPHETKPDEDAEAFENHAEKRGKR
ITKSAHKKKDSPEPQGKTDKHEPHQDSGEEAEGCPSAPEETPADKKPEVHEKAKRKSTRP
HDEEEGEDDDLQGVGEELSSSPPSSRVSLETLGSHSEEGLDFKPSPPLSKVSVIPHDLFY
FPHYEVPLAAVLEAYAEDPEDLKNEEMDLEEPEGCMPDLDPREEEAGGSQSSSSSSVPGE
SLPSASDQVLCLSRGGAGTTPASEPTPPAPHEEHQQRETKENDPMDSHQSQESPNPENIA
NPLEGNVTKESISSKKKEKRKHVDHVESSLFVAPGSIQSSDDLEEDTSDHCIPSRTSHSD
SSIYIRRHTNRSSESDHFSYVQLRNAADLDDRRNRMLTRKANSSGEAMSLGSHSPQSDSL
TQLVQQPDMMYFILFLWLLVYCLLLFPQLDVNRL
Download sequence
Identical sequences ENSMMUP00000000917 ENSMMUP00000000917 9544.ENSMMUP00000000917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]