SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000001071 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000001071
Domain Number 1 Region: 20-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.15e-71
Family Calponin-homology domain, CH-domain 0.000007
Further Details:      
 
Domain Number 2 Region: 1524-1740
Classification Level Classification E-value
Superfamily Plakin repeat 2.22e-44
Family Plakin repeat 0.00022
Further Details:      
 
Domain Number 3 Region: 1745-1927
Classification Level Classification E-value
Superfamily Plakin repeat 5.58e-40
Family Plakin repeat 0.00067
Further Details:      
 
Domain Number 4 Region: 6543-6702
Classification Level Classification E-value
Superfamily Spectrin repeat 2.55e-28
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 5 Region: 6763-6919
Classification Level Classification E-value
Superfamily Spectrin repeat 3.7e-28
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 267-383
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-27
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 7 Region: 6373-6486
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-26
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 8 Region: 5884-6043
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-24
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 9 Region: 6125-6265
Classification Level Classification E-value
Superfamily Spectrin repeat 2.28e-24
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 10 Region: 5341-5498
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-24
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 11 Region: 4572-4731
Classification Level Classification E-value
Superfamily Spectrin repeat 1.94e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 6915-7030
Classification Level Classification E-value
Superfamily Spectrin repeat 6.6e-21
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 13 Region: 4905-5059
Classification Level Classification E-value
Superfamily Spectrin repeat 9.97e-21
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 14 Region: 7250-7329
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.19e-19
Family GAS2 domain 0.00053
Further Details:      
 
Domain Number 15 Region: 5777-5934
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-19
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 16 Region: 4123-4262
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-18
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 17 Region: 6259-6376
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-18
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 18 Region: 701-803
Classification Level Classification E-value
Superfamily Spectrin repeat 3.89e-16
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 19 Region: 1236-1364,1391-1419
Classification Level Classification E-value
Superfamily Spectrin repeat 4.96e-16
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 20 Region: 5118-5278
Classification Level Classification E-value
Superfamily Spectrin repeat 5.4e-16
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 21 Region: 5494-5609
Classification Level Classification E-value
Superfamily Spectrin repeat 8.38e-16
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 22 Region: 7161-7241
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000137
Family Polcalcin 0.044
Further Details:      
 
Domain Number 23 Region: 4793-4915
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000704
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 24 Region: 5676-5824
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000152
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 25 Region: 3874-3995
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000403
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 26 Region: 6042-6154
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000445
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 27 Region: 4042-4154
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000249
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 28 Region: 4321-4441
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000144
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 4480-4589
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000177
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 30 Region: 777-883,1004-1024
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000374
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 31 Region: 608-700
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000196
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 32 Region: 7040-7101
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000878
Family Spectrin repeat 0.0068
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000001071
Domain Number - Region: 3389-3498
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000403
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 3641-3754
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00288
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number - Region: 1030-1171
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0115
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000001071
Sequence length 7544
Comment (Macaca mulatta)
Sequence
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLY
EDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQLKLCSLEYRKISR
KNRRVSLRFICSLSHQFMISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDE
KSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTTMSERTFP
NNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIAHRVQRDSVICEDKLILARNALQSDSKRLES
GVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNEC
SSVYSKGRMLTTEQTKLVISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGSVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTE
EEINMKFVQDLLNWVEEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKI
SEIQMTATLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNVARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYR
AAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSI
HKLEDLVQESMEEKEELLQYKSTIASLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDFANRIEQQYQ
NVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFL
EDSQESQIFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLE
NCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAAS
SSVPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEA
VIADKNNIENLISTLKQWRSEVDEKRQVFHALQDELQKAKAISDEMFKTYKERDLDFDWH
KEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQ
PENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQ
KSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKK
EHVEKAKELQKWVSNISKTLKDAEKAGKPPFSMQKISSEEISTKKEQLSETLQAMQLFLA
KHGDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGDVKVEEKLDKVIAGTID
QTTGEVLSVFQAVLRGLIDYDTGIRLLETQLMISGLISPELRKSFELNDAKSHGLIDEQI
LCQLKELNKAKEIISAASPTTIPVLDALAQSMISESMAIKVLEILLSTGALVIPATGEQL
TLQKAFQQNLVSSALFSKVLERQNMCKDLIDPCTSEKVSLIDMVQRSTLQENTGMWLLPV
RPQEGGRITLKCGRNLSILRAAHEGLIDRETTFRLLSAQLLSGGLINSNSGQRMTVEEAV
REGVIDRDTASSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLITSSSALLVLEAQRGYVG
LIWPHSGEIFPTSSSLQQELITNELAYKILNSRQKIAALYIPESSQVIGLDAAKQLGIID
NNTASILKNIILPDKMPDLGDLEACKNARRWLSFCKFQPSTVHDYRQEEDVFDGEEPVTT
QTSEQTKKLFLSYLMINSYMDANTGQRLLLYDGDLDEAVGVLLEGCHAEFDGDTAIKECL
DVLSSSGVFLNNASGREKDECTTAPSSFNKCHCGEPEHEETPENRKCAVDEEFHEMGNNV
INSEFSQSEKPASTISIDPKVNSSPSVCVPSPISHLTQTELADISMLRNDSENILTNYEN
QSQVETNEHANECSHSKNIQNFPGDLIENPIVKSKMNKFCGVNETENEDNTNRDSPIFDY
SPRLSALLSHDKLRHRQGSFNDTHTPESNGNKCEAQTLSFSDKTMLSGQRIGEKFQDQFL
GIAAINISLPGEQYGQKSLNMISSNPQVQCHNDKYISDTSGEDEKTHPGFQQMPEDKKNE
SEVEEYSCAVTPGGDTDNAIVSLTSATPLLDETISAGDYETSLLNDQQNDTGTDTDSDDD
FYDTPLFEDDDHDSLLLDGDDHDCLHPEDYDTLQEENDEMASPADVFYDVLKENENSVVP
QGALAGSLSVKGKAQCRQDFLMNVEKDELDSGEKIHLNPVDSDKVNRQSLETGSERECTN
ILEGDESDSLTDYDIVGGKESFTASLKFDDNGSWRVRKEEYVTVQEFHSDTDHLDSMQSE
ESYGDYIYDSNDQDDDDNDGTDEEGGCIRDENGKRRCQDVAEDMDIQLCASIVNENSDEN
KNTNKMILLDKMHSCSSLEKQQRVNVVHLASPSENSLATEESNLPEYTIEIVGKSKENLL
NHEMVLKDLLLPIIKDTECEKTFGPASISHNSNISSTSELGNDLANTKVKLIQGSELPEL
TDSVKGKDQYYKNMAPKIDSSLDHLICTEPDLMGKPAEESHLSSIASVTDKDPQGNGSDL
IKGRDGKSDILIEDETSIQKIYLGEGEVLVEGLVEEENRHLKLLPGENTRDSFKLINSQF
PFSQITNNEELNQKGSLKKATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSKEMSDD
ITSDITSWEGNTHFEESFTDGPEKELDLFTYLKHCAKNIKAKGVAKPNEDVPSHVLITAP
PMKEHLQLGVNNTKEKSTSTQKDSPINEMIQSNDLCSKESISGGGTEISQFTPESIEATL
SILSLKHVEDVGKNDFLQSDQCANGLGNDNSSNTLNTDYSFLEISNKKERIEQQLPKEQA
LSPRPQEKEVEIPELSQVFVEDVKDILKSRLKEGHMNPQEVEEPSACADTEILVQNLIKQ
ITTSQLVNEASTVPSDSQMSDSSGVSPMSNSSELKAESRDDPFCLGNLKSELLLNILKQD
QHSQKITGLFELMRELTHMEYDLEKRGITSKVLPLQLENIFYKLLADGYSEKIEHAGDFN
QKACSTSEMMEEKPHILSDIKSKEVNHYSPNLETVKEIGLESSTVCASALPRDEKLKDLC
DDFPSHLECISGSKEMASGDSSTEQFSSELQQCLQHTEKMHEYLTLLQDMKPPLDNQESL
DNNLEALKNQLRQLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHLEELSISHQS
LKTAFSSLSNVASERTKQIMLAIDSEMSKLAVSHEEFLQKLKSFSDWISEKSRSVKDIEI
VNVQDSEYVKKRLEFLKAKNVLKDLGHTKMQLETTAFDVQFFISEYAQDLSPNQSKQLLR
LLNTTQKCFLDVQESVTTQVERLETQLHLEQDLDDQKIVAERQQEYKEKLQGICDLLTQT
ENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKNTENFLKENGEKLS
REDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKI
ENLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQV
GPTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLSPEEKEKLQKNMKE
LKAHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDLNGL
MTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGQVDTSATHREVQHKLD
HATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLSGLQACEATASKHLSEPIAVDP
KNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYE
DLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGSVESSLKEQGQVPLNSAALQDIISK
NIMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQARMKDLSARFSEASHKHKETLA
KMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKD
LEVLHSLLKEISSHGLPSDKALVFEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQV
LVKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTPEIQKVNNSGISLC
NLISAVTTPAKAIAAVKSGGAILNGEGTATNTEEFWANKGLTSIKKDMTDISHDYEDLGL
LLKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWHQTPAPTDTEAVKTQVEQNK
SFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKWQELNQLTIDRQQK
LEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRK
PQYEQLTAAGQGILSRPGEDPSLHGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKST
QYQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEIQQEKKQIKVAQAL
CEDLSALVKEEYLKAELSRQLEGILKSFKDIEQKAESHVQHLQSACASSHQFQQMSRDFQ
AWLDTKKEEQNKSHPISAKLNVLESLIKDHKDFSKTLTAQSHIYEKTIAEGENLLLKTQG
SEKAALQLQLNTIKTSWDTFNKQVKERENKLKDSLEKALKYKEQVETLRPWIDKCQNNLE
EIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSL
IQKVDMVTEQLHSKKFSLENMAQKFKEFQEVSKESKRQLHCAKEQLDIYDSLGPQAYSNK
YLTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQAETIAQEHSALSQQV
DEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLK
KLEALIASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGT
IKRLEEFYSKLKEFSTLLQKAEEHEESQGPVGMETETINQQLEVFKVFQKEEIEPLQGKQ
QDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQD
ALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKI
ATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTT
IEKRLVNCEPIGTQASKLEEQISQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDM
VQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQ
DYSTEGLWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKAR
YKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEAASQAQ
VRQKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQK
VEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEIL
RHKDIIDELVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLV
NQFWETYEELWPWLTETQSVISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNK
TGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILE
SLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGT
DKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLVVTIKDTQD
FIRDLEDPGIDPSVVKQQQEAAEAIREEIDGLQEELDIVINLGSELIAACGEPDKPIVKK
SIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGGKLASMSPIGTD
LETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIWD
SLEERIINRQHKLEGALLALGQFQHALDELLTWLTHTEGLLSEQKPVGGDPKAIEIELAK
HHVLQNDVLAHQSTVEAVNKAGNDLIESSAGERSSNLQKQLQVLNPRWQNVLEKTEQRKQ
QLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNVHMEVCAAFEAK
EETYKSLMQKGQHMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEALNLAME
FHNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHREQIIELDKTG
THLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKLMEW
LEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLAD
DNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAE
DQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQEL
STRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLPDDEDALR
TLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWA
KQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTF
MEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQIE
TKNPRVNLLLREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGI
LSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPITDADKIEDEVTRQV
AKCKCAKRFQVEQIGDNKYRVSFQNNFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVK
NDPCRVHHHGSKMLRSESNSSITTTQPTIAKGRTNMELREKFILADGASQGMAAFRPRGR
RSRPSSRGASPNRSTSVSSQAAQAATPQVPATTTPKGTPIQGSKLRLPGYLSGKGFHSGE
DSGLITTAAARVRTQFADSKKTPSRPGSRAGSKAGSRASSRRGSDASDFDISEIQSVCSD
VETVPQTHRPTPRAGSRPSTAKPSKIPTPQRKSPASKLDKSSKR
Download sequence
Identical sequences ENSMMUP00000001063 9544.ENSMMUP00000001071 ENSMMUP00000001071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]