SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000002262 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000002262
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.97e-48
Family Calponin-homology domain, CH-domain 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000002262
Sequence length 329
Comment (Macaca mulatta)
Sequence
MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGTNFQLGLKDGIILCE
LINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQT
TLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMT
AYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDN
STISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDY
QAEYPDEYHGEYQDDYPRDYQYSDQGIDY
Download sequence
Identical sequences A0A096MP12 A0A2I3HF96 A0A2J8VCQ9 A0A2K5HPX8 A0A2K5NMT2 A0A2K6D474 A0A2K6LLQ4 A0A2K6P815 F7G309 G3RDC6 H2PZF7
ENSPANP00000001445 ENSGGOP00000013526 ENSNLEP00000013635 NP_001248738.1.72884 XP_003260125.1.23891 XP_003808496.1.60992 XP_004026218.1.27298 XP_005542714.1.63531 XP_009423522.1.37143 XP_010383442.1.97406 XP_011746077.1.29376 XP_011795410.1.43180 XP_011923289.1.92194 XP_017735283.1.44346 ENSMMUP00000002262 ENSGGOP00000013526 ENSMMUP00000002262 9544.ENSMMUP00000002262 ENSPTRP00000001688 ENSNLEP00000013635 ENSPTRP00000001688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]