SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000005726 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000005726
Domain Number 1 Region: 129-171
Classification Level Classification E-value
Superfamily SAP domain 0.000000000000298
Family SAP domain 0.0086
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000005726
Domain Number - Region: 31-111
Classification Level Classification E-value
Superfamily Saposin 0.0144
Family NKL-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000005726
Sequence length 184
Comment (Macaca mulatta)
Sequence
RRRRRMWATQGLAVALALSVLPGGRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIEN
ELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICE
LKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASA
RTDL
Download sequence
Identical sequences 9544.ENSMMUP00000005726 ENSMMUP00000005726 ENSMMUP00000005726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]