SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000007660 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000007660
Domain Number 1 Region: 142-234
Classification Level Classification E-value
Superfamily Fibronectin type III 7.69e-24
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 2 Region: 259-351
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-20
Family I set domains 0.0053
Further Details:      
 
Domain Number 3 Region: 61-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000161
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000007660
Sequence length 354
Comment (Macaca mulatta)
Sequence
MEAATAPEVAVGSKLKVKEVSPADAEPPQASPGQGAGSPTPQLLPPIEEHPKIWLPRALR
QTYIRKVGDTVNLLIPFQGKPKPQAIWTHDGCALDTSRVSVRNGERDSILFIREAQRADS
GRYQLRVQLGGLEATATIDILVIERPGPPQSIKLVDVWGFNATLEWTPPQDTGNTALLGY
TVQKADTKSGLWFTVLEHYHRTSCIVSDLIIGNSYAFRVFAENQCGLSETAPITTDLAHI
QKAATVYKIKGFAQRDFSEAPKFTQPLADCTTVTGYNTQLFCCVRASPRPKIIWLKNKMD
IQGNPKYRALTHLGICSLEIRKPGPFDGGIYTCKAVNPLGEASVDCRVDVKVPN
Download sequence
Identical sequences A0A2K5X3B7 A0A2K5ZUV9
ENSMMUP00000007660 9544.ENSMMUP00000007660 ENSMMUP00000007660 XP_001089938.1.72884 XP_011824108.1.47321 XP_015003191.1.72884 XP_015287187.1.63531 XP_015287198.1.63531 XP_015287206.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]