SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000009714 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000009714
Domain Number 1 Region: 37-150
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.29e-41
Family Interleukin 17F, IL-17F 0.000069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000009714
Sequence length 155
Comment (Macaca mulatta)
Sequence
MTPGKTSLVLLLLLLSLEAIVKAGIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNP
KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEIL
VLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA
Download sequence
Identical sequences F6T3G5
ENSMMUP00000009714 ENSMMUP00000009714 XP_001106391.1.72884 9544.ENSMMUP00000009714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]