SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000011911 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000011911
Domain Number 1 Region: 1-109,172-223
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.95e-32
Family Hemopexin-like domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000011911
Sequence length 232
Comment (Macaca mulatta)
Sequence
GHYFWMLSPFSPPSPARRITEVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRFTNDIKDA
GYPKPIVKGFGGLTGQIVAALSIAKYKNRPESVYFFKRGGSIQQYIYKQEPVQKCPGRRP
ALNYPVYGETTQVRRRRFERAIGPSLTHTIRIHYSPVRLAYQDKGFLHNEVKVSTLWRGL
PNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSK
Download sequence
Identical sequences G7NXF2
ENSMMUP00000011911 9544.ENSMMUP00000011911 ENSMMUP00000011911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]