SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000016286 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000016286
Domain Number 1 Region: 120-621
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.48e-158
Family Calponin-homology domain, CH-domain 0.00000000282
Further Details:      
 
Domain Number 2 Region: 5-95
Classification Level Classification E-value
Superfamily EF-hand 5.87e-20
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000016286
Sequence length 629
Comment (Macaca mulatta)
Sequence
MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKII
SVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSSISSEGTQHSY
SEEEKVAFVNWINKALENDPDCKHLIPMNPNDDSLFKSLADGILLCKMINLSEPDTIDER
AINKKKLTPFTVSENLNLALNSASAIGCTVVNIGASDLKEGKPHLVLGLLWQIIKVGLFA
DIEISRNEALIALLNEGEELEELMKLSPEELLLRWVNYHLTNAGWHTISNFSQDIKDSRA
YFHLLNQIAPKGGEDGPAIAIDLSGINETNDLKRAGLMLQEADKLGCKQFVTPADVVSGN
PKLNLAFVANLFNTYPCLHKPNNNDIDMNLLEGESKEERTFRNWMNSLGVNPYINHLYSD
LTDALVIFQLYEMIRVPVNWSHVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGIA
GQDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSANKKTSIS
SFKDKSISTSLPVLDLIDAIAPNAVRQEMIRRENLSDEDKLNNAKYAISVARKIGARIYA
LPDDLVEVKPKMVMTVFACLMGKGLNRIK
Download sequence
Identical sequences A0A096NA44 A0A2K5MAY2 A0A2K5XKC6 F7EA87 G7P009
ENSPANP00000009541 9544.ENSMMUP00000016286 ENSMMUP00000016286 ENSMMUP00000016286 XP_005546053.1.63531 XP_005546054.1.63531 XP_011856647.1.47321 XP_011856655.1.47321 XP_011916595.1.92194 XP_011916596.1.92194 XP_011916598.1.92194 XP_011916599.1.92194 XP_011916600.1.92194 XP_011916601.1.92194 XP_011916602.1.92194 XP_014987474.1.72884 XP_014987475.1.72884 XP_014987476.1.72884 XP_015300669.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]