SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000017522 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000017522
Domain Number 1 Region: 240-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 404-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-18
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 3-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000017
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 
Domain Number 4 Region: 182-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000272
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000178
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 144-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000137
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 450-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000729
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 296-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000239
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 490-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000119
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000017522
Sequence length 546
Comment (Macaca mulatta)
Sequence
KEKLKFRDVVIEFSLVEPQCPDTAQWNLYSNVMLENYRNVVFLGIAVSKPDLITCLEQEK
ESWTTKRQEMIAKSPVMCSHFSQDFWPEQIIKDSFQKVTLRGYGKCKHENLQLRKHGKCV
NDCKVPKRGYNGLDQCLLTTQCEVFECDKYVKMFHKSSNLNGHKIRHTGKKPFKCEECDK
LFCMFSNLTQHKLIYTRVNFYKCEDYGKAFNASSIFSKHKRIHIGEEPYKCEECGNTINQ
FSNLTIHKVIYTREKPYKCEKCGKAFDLSSYFTTHQIIHTGEKPCKFEECGKVFNQSSIL
THKIIHTREKFNKYKECGKDFNKPAYISEHEKIHTREKLSKGVECGEAFNQSSHLTRHKI
IHTTEILYKCEEYCTAFRQSPHPITHKIIHTGEKTCKYEECDKAFNKSSHLTRHKSIHTK
EKPYQCYEECGKVFNHFSHLSTHKIIHTAEKSYQCEKCGKVFNQSSHLTRKRNHTGEKPY
QCEECVKDFNLAGHKKIHICEKLYKPKRYNSDFDNTSNFSKHKRNCTGEQIKNLYKCEEC
GKTFNQ
Download sequence
Identical sequences 9544.ENSMMUP00000017522 ENSMMUP00000017521 ENSMMUP00000017522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]