SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000017986 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000017986
Domain Number 1 Region: 32-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.83e-80
Family Calponin-homology domain, CH-domain 0.000087
Further Details:      
 
Domain Number 2 Region: 1332-1444
Classification Level Classification E-value
Superfamily E set domains 3.67e-36
Family Filamin repeat (rod domain) 0.0000249
Further Details:      
 
Domain Number 3 Region: 1844-1955
Classification Level Classification E-value
Superfamily E set domains 6.7e-36
Family Filamin repeat (rod domain) 0.0000035
Further Details:      
 
Domain Number 4 Region: 1533-1641
Classification Level Classification E-value
Superfamily E set domains 5.4e-33
Family Filamin repeat (rod domain) 0.0000066
Further Details:      
 
Domain Number 5 Region: 457-573
Classification Level Classification E-value
Superfamily E set domains 7.34e-33
Family Filamin repeat (rod domain) 0.00034
Further Details:      
 
Domain Number 6 Region: 1435-1543
Classification Level Classification E-value
Superfamily E set domains 1.13e-32
Family Filamin repeat (rod domain) 0.000026
Further Details:      
 
Domain Number 7 Region: 1062-1157
Classification Level Classification E-value
Superfamily E set domains 1.47e-30
Family Filamin repeat (rod domain) 0.0000145
Further Details:      
 
Domain Number 8 Region: 671-778
Classification Level Classification E-value
Superfamily E set domains 4.52e-30
Family Filamin repeat (rod domain) 0.00033
Further Details:      
 
Domain Number 9 Region: 850-971
Classification Level Classification E-value
Superfamily E set domains 8.67e-30
Family Filamin repeat (rod domain) 0.00041
Further Details:      
 
Domain Number 10 Region: 1144-1252
Classification Level Classification E-value
Superfamily E set domains 8.67e-30
Family Filamin repeat (rod domain) 0.0000901
Further Details:      
 
Domain Number 11 Region: 2036-2138
Classification Level Classification E-value
Superfamily E set domains 9.75e-30
Family Filamin repeat (rod domain) 0.0000191
Further Details:      
 
Domain Number 12 Region: 1242-1353
Classification Level Classification E-value
Superfamily E set domains 2.74e-29
Family Filamin repeat (rod domain) 0.0000124
Further Details:      
 
Domain Number 13 Region: 554-666
Classification Level Classification E-value
Superfamily E set domains 6.67e-29
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 14 Region: 2233-2328
Classification Level Classification E-value
Superfamily E set domains 2.2e-27
Family Filamin repeat (rod domain) 0.000004
Further Details:      
 
Domain Number 15 Region: 378-477
Classification Level Classification E-value
Superfamily E set domains 3.89e-26
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 16 Region: 2427-2519
Classification Level Classification E-value
Superfamily E set domains 5.27e-26
Family Filamin repeat (rod domain) 0.00000999
Further Details:      
 
Domain Number 17 Region: 1630-1742
Classification Level Classification E-value
Superfamily E set domains 7.92e-26
Family Filamin repeat (rod domain) 0.0000675
Further Details:      
 
Domain Number 18 Region: 279-391
Classification Level Classification E-value
Superfamily E set domains 8.67e-25
Family Filamin repeat (rod domain) 0.00096
Further Details:      
 
Domain Number 19 Region: 2334-2425
Classification Level Classification E-value
Superfamily E set domains 2.6e-24
Family Filamin repeat (rod domain) 0.0000141
Further Details:      
 
Domain Number 20 Region: 2555-2646
Classification Level Classification E-value
Superfamily E set domains 5.4e-24
Family Filamin repeat (rod domain) 0.0000189
Further Details:      
 
Domain Number 21 Region: 948-1065
Classification Level Classification E-value
Superfamily E set domains 2.4e-23
Family Filamin repeat (rod domain) 0.0006
Further Details:      
 
Domain Number 22 Region: 768-869
Classification Level Classification E-value
Superfamily E set domains 3.15e-23
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 23 Region: 2156-2249
Classification Level Classification E-value
Superfamily E set domains 4.94e-21
Family Filamin repeat (rod domain) 0.0000108
Further Details:      
 
Domain Number 24 Region: 1961-2059
Classification Level Classification E-value
Superfamily E set domains 4.54e-18
Family Filamin repeat (rod domain) 0.0000933
Further Details:      
 
Domain Number 25 Region: 1788-1860
Classification Level Classification E-value
Superfamily E set domains 7.37e-16
Family Filamin repeat (rod domain) 0.0000702
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000017986
Sequence length 2647
Comment (Macaca mulatta)
Sequence
MSSSHSRAGQSAAGAAPGGGADTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSTFEVYVDKSQGDASKVTAQGPGLSRSGNIANKTTYFEIFTAGAGTGEVEVVI
QDPAGQKGTVEPQLEARGDSTYRCTYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
SACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPTVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSDDIRLSPFM
ADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE
ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK
AAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSP
FSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKV
EPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPVEAVAPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE
AGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGTYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYIICVRFGGEHVPNSPFQVTA
LAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDMTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPAITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGDPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKSHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFIVNTSNAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADAAKVVAKGLGLSKAYIGQKSSFTV
DCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS
PYRVVVP
Download sequence
Identical sequences ENSMMUP00000017986 ENSMMUP00000000963 9544.ENSMMUP00000017986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]