SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000018059 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9544.ENSMMUP00000018059
Domain Number - Region: 55-133
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0066
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 
Domain Number - Region: 135-202
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 0.0589
Family TF C-terminus 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000018059
Sequence length 305
Comment (Macaca mulatta)
Sequence
MAAAGWGKGSLTLTAAALAKSPSLSPQLAAPIRGRPKKCLVYPHAPKNSHLSRSVLRWLQ
GLDLSFFPRNINRDFSNGFLIAEIFSIYYPWELELSSFENGTSLKVKLDNWAQLEKFLAR
KKFKLPKELIHGTIHCKAGVPEILIEEVYTLLTHREIKSIQDDSVNFTDYSYQRHLPLVS
RSTASKSIKDNIRLSELLSNPNMLSNELKAEFLILLHMLQRKLGRKLNPEWFDVKPTVGE
VTLNHLPAQACGHRYNSKVTRGRVALVLPNIGNGGNSNREIHVKQAGQHSHYSVMKPIRN
MEKKP
Download sequence
Identical sequences A0A2K5X5T8 Q3HM42
ENSMMUP00000018059 NP_001030604.1.72884 9544.ENSMMUP00000018059 ENSMMUP00000018059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]