SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000022282 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000022282
Domain Number 1 Region: 10-199
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.39e-35
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 2 Region: 2117-2258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000381
Family Extended AAA-ATPase domain 0.085
Further Details:      
 
Domain Number 3 Region: 2152-2187,2265-2381
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000205
Family Nitrogenase iron protein-like 0.076
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000022282
Domain Number - Region: 1933-1960
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0942
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000022282
Sequence length 2488
Comment (Macaca mulatta)
Sequence
MPAILVASKMKSGLPKPVHSAAPILHVPPARAGPQPCYLKLGSKVEVSKTTYPSQIPLKS
QVLQGLQEPAGEGLPLRKSGSVENGFDTQIYTDWANHYLAKSGHKRLIKDLQQDVTDGVL
LAQIIQVVANEKIEDINGCPKNRSQMIENIDACLNFLAAKGINIQGLSAEEIRNGNLKAI
LGLFFSLSRYKQQQQQPQKQHLSSPLPPAVSQVAGAPSQCQAGTPQQQVPAAPQALCQPH
QPAPHQQSKAQAEMQSSASSKDSSQSKIIRFTLGQKKISRLPGPTARVSAAGSEAKTRGG
STTANNRRSQSFNNYDKSKPVTSPPPPPSSHEKEPLASSASSHPGMSDNAPASLESGSSS
TPTNYSTSSAIPQPGAATKPWRSKSLSVKHSATVSMLSVKSPGPEAPRPTPEAMKPASNN
QKSMLEKLKLFNSKGGSKAGEGPGSRDTSCERLETLPSFEESEELEAASRMLTTVGPASS
SPKIALKGIAQRTFSRALTNKKSSPKGNEKEKEKQQREKDKEKSKDLAKRASVTERLDLK
EEPKEDPSGAALPEMPKKSSKIASFIPKGGKLNSAKKEPMAPSHSGIPKPGMKSMPGKSP
SAPAPSKEGERSRSGKPSSGLPQQKPQLDGRHSSSSSSLASSEGKGPGGTTLNHSISSQT
VSGSIGTTQTTGSNTVSVQLPQPQQQYNHPNTATVAPFLYRSQTDTEGNVTAESGSTGVS
MEPSHFTKTGQPALEELTGEDPEARRLRTVKNIADLRQNLEETMSSLRGTQVTHSTLETT
FDTNVTTEMSGRSILSLTGRPTPLSWRLGQSSPRLQAGDAPSMGNGYPPRANASRFINTE
SGRYVYSAPLRRQLASRGSSICHVDVSDKAGDEMDLEGISMDAPGYMSDGDVLSKNIRTD
DITSGYMTDGGLGLYTRRLNRLPDGMAVVRETLQRNTSLGLGDADSWDDSSSVSSGISDT
IDNLSTDDINTSSSISSYANTPASSRKNLDVQTDAEKHSQVERNSLWSGDDVKKSDGGSD
SGIKMEPGSKWRRNPSDVSDESDKSTSGKKNPVISQTGSWRRGMTAQVGITMPRTKPSAP
AGALKTPGTGKTDDAKVSEKGRLSPKASQVKRSPSDAGRSSGDESKKPLPSSSRTPTANA
NSFGFKKQSGSAAGLAMITASGATVTSRSATLGKIPKSSALISRSAGRKSSMDGAQNQDD
GYLAISSRTNLQYRSLPRPSKSTSRNGAGNRSSTSSIDSNISSKSAGLPVPKLREPSKTA
LGSSLPGLVNQTDKEKGISSDNESVASCNSVKVNPAAQPVSSPAQAGLQPGAKYPDVASP
TLRRLFGGKATKQVPIATAENMKNSVVISNPHATMTQQGNLDSPSGSGVLSSGSSSPLYS
KNVDLNQSPLASSPSSAHSAPSNSLTWGTNASSSSAVSKDGLGFQSVSSLHTSCESIDIS
LSSGGGPSHNSSTGLITSSKDDSLTPFVRTNSVKTTLSESPLSSPAASPKFCRSTLPRKQ
DSDPHLDRNTLPKKGLRYTPTSQLRTQEDAKEWLRSHSAGGLQDTASNSPFSSGSSVTSP
SGTRFNFSQLASPTTVTQMSLSNPTMLRTHSLSNADGQYDPYTDSRFRNSSMSLDEKSRT
MSRSGSFRDGFEEESWEKSSVDNFVSRFHSSLHFSLPLFHHPRYELIHGSSLSLVSSTSS
IYSTPEEKCQSEIRKLRRELDASQEKVSALTTQLTANAHLVAAFEQSLGNMTIRLQSLTM
TAEQKDSELNELRKTIELLKKQNAAAQAAINGVINTPELNCKGNGTAQSADLRIRRQHSS
DSVSSINSATSHSSVGSNIESDSKKKKRKNWVNELRSSFKQAFGKKKSPKSASSHSDIEE
MTDSSLPSSPKLPHNGSTGSTPLLRNSHSNSLISECTDSEAETVMQLRNELRDKEMKLTD
IRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVSISASPRQ
SMGLSQHSLNLTESTSLDMLLDDTGECSARKEGGRHVKIVVSFQEEMKWKEDSRPHLFLI
GCIGVSGKTKWDVLDGVVRRLFKEYIIHVDPVSQLGLNSDSVLGYSIGEIKRSNTSETPE
LLPCGYLVGENTTISVTVKGLAENSLDSLVFESLIPKPILQRYVSLLIEHRRIILSGPSG
TGKTYLANRLSEYMVLREGRELTDGVIATFNVDHKSSKELRQYLSNLADQCNSENNAVDM
PLVIILDNLHHVSSLGEIFNGLLNCKYHKCPYIIGTMNQATSSTPNLQLHHNFRWVLCAN
HTEPVKGFLGRFLRRKLMETEISGRVRNMELVKIIDWIPKVWHHLNRFLEAHSSSDVTIG
PRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQLYGRRAPWEDPAKWVMDTYPW
AASPQQHEWPPLLQLRPEDVGFDGYSMPREGSTSKQVPPSDAEGDPLMNMLMRLQEAANY
SSPQSYDSDSNSNSHHDDILDSSLESTL
Download sequence
Identical sequences ENSMMUP00000022282 9544.ENSMMUP00000022282 ENSMMUP00000022282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]