SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000023129 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000023129
Domain Number 1 Region: 14-152
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-32
Family Calponin-homology domain, CH-domain 0.00081
Further Details:      
 
Domain Number 2 Region: 600-678
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.58e-22
Family DIX domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000023129
Sequence length 683
Comment (Macaca mulatta)
Sequence
MLACLTRGNLLDVLQEGFNEQQLQAYVAWVNSQLKKRPAVKPVQDLRQDLRDGVILAYLI
EIVAGEKLSGVQLSPSNQQEMKNNVEKVLQFVASKKIRMHQTSAKDIVDGNLKSIMRLVL
ALAAHFKPGSSRTVNQGRDSRAPLQSHRPHCATAVAQGAAAALADVCHDMSRSGRDVFRY
RQRNSSMDEEIENPYWSVRALVQQYEGQQRSPSESSCSSLTSPSPIHSAKSESIITQSEE
KADFVIIPSEGIETRTEETESPLSRDWRPGSPGTYLETSWEEQLLEQQEYLEKEMEEAKK
MISGLQALLLNGSLPEDEQERPLAFCEPGVNPEEQLIIIQSRLDQSMEENQDLKKELLKC
KQEARNLQGIKDALQQRLTQQDTSVLQLKQELLRANMDKDELHNQNVDLQRKLDERNRLL
GEYKKELGQKDRLLQQHQAKLEEALRKLSDASYHQVDLERELEHKDVLLAHCMKREADEV
TNYNSHNSQSNGFLLPTAGKGAASISNRGTSDLQLVRDALRSLRNSFSGHDPQHHTIDSL
EQGISSLMERLHVMETQKKQERKVRVKSPRTQVGSEYRESWPPNSKLPHSQSSPTVSSTC
TKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDREGNHRYHFKALDPEFGTVKEEIFH
DDDAIPGWEGKIVAWVEEDHGEN
Download sequence
Identical sequences A0A2K5Z516 F6WSA9 G7PNT1
ENSMMUP00000023129 ENSMMUP00000023129 XP_001106684.1.72884 XP_005579662.1.63531 XP_011832370.1.47321 9544.ENSMMUP00000023129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]