SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000024792 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9544.ENSMMUP00000024792
Domain Number - Region: 119-169
Classification Level Classification E-value
Superfamily Cullin homology domain 0.0445
Family Cullin homology domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000024792
Sequence length 175
Comment (Macaca mulatta)
Sequence
MGALVIRGIRNFNVENRAEREISKIKPSLAPRHPSTSNLLQEQISHYPEIKGEIARKDDK
LLSFLKDVYVDSKDPVSSLQVKAAETCQEPKEFRLPKGHQFGMINMKSIPKGKISVVEAL
TLLNNHKLYPETWTAEKIVQEYQLEKKDVNSLLKYFVTFEVKIFTPEDKKAIQSK
Download sequence
Identical sequences F6ZAR5
9544.ENSMMUP00000024792 ENSMMUP00000024792 NP_001247683.1.72884 ENSMMUP00000024792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]