SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000027657 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000027657
Domain Number 1 Region: 166-207
Classification Level Classification E-value
Superfamily Elafin-like 0.000000196
Family Elafin-like 0.0019
Further Details:      
 
Domain Number 2 Region: 75-114
Classification Level Classification E-value
Superfamily Elafin-like 0.000000484
Family Elafin-like 0.0017
Further Details:      
 
Domain Number 3 Region: 26-67
Classification Level Classification E-value
Superfamily Elafin-like 0.00000157
Family Elafin-like 0.0021
Further Details:      
 
Domain Number 4 Region: 124-159
Classification Level Classification E-value
Superfamily Elafin-like 0.00000301
Family Elafin-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000027657
Sequence length 231
Comment (Macaca mulatta)
Sequence
MMLSCLFLVKALLALGSLESWITAGEHAKEGECPPDKNPCKELCQGDELCLAGQKCCTTG
CGRICRDIPKGRKRDCPRVIRKQSCLKRCITDETCPGVKKCCTFGCNKSCVVPISKQKPA
EFGGECPADPLPCEELCDGDASCPQGHKCCSTGCGHTCLGDIEGGQGGDCPKVLVGLCIV
GCVMDENCQAGEKCCKSGCGRFCVPPVLPRKLTVNPNWTVRSDSELEIPVP
Download sequence
Identical sequences ENSMMUP00000027657 ENSMMUP00000027657 XP_015004418.1.72884 9544.ENSMMUP00000027657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]