SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000027875 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000027875
Domain Number 1 Region: 14-150
Classification Level Classification E-value
Superfamily Macro domain-like 1.19e-34
Family Macro domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000027875
Sequence length 151
Comment (Macaca mulatta)
Sequence
MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLN
QQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGPEDLSLMIG
CGLDRLQWENVSAMIEEVFEATDIKITVYTL
Download sequence
Identical sequences ENSMMUP00000027875 9544.ENSMMUP00000027875 ENSMMUP00000027875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]