SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000028092 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000028092
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.62e-35
Family Calponin-homology domain, CH-domain 0.00089
Further Details:      
 
Domain Number 2 Region: 1937-2074
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000228
Family Nucleotide and nucleoside kinases 0.089
Further Details:      
 
Domain Number 3 Region: 1966-2013,2084-2168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000013
Family Nucleotide and nucleoside kinases 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000028092
Sequence length 2301
Comment (Macaca mulatta)
Sequence
QQIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQIIANEKVEDINGCPRSQSQMI
ENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRYKQQQHHQQQYYQSLVEL
QQRVTHASPPSEAGQAKTQQDMQSSLAARYATQSNHSGIATSQKKPTRLPGPSRVPAAGS
SSKVQGASNLNRRSQSFNSIDKNKPPNYANGNEKDSSKGPQSSSGVNGNMQPPSTAGQPP
ASAIPSPSASKPWRSKSMNVKHSATSTMLTVKQSSPATSPTPPSDRLKPPVSEGVKTAPS
GQKSMLEKFKLVNARTALRPPQPPSSGPSDGGKDDDAFSESGEMEGFNSGLNSGGSTNSS
PKVSPKLAPPKAGSKNLSNKKSLLQPKEKEEKNRDKNKVCTEKPVKEEKDQVTEMAPKKT
SKIASLIPKGSKTTAAKKESLIPSSSGIPKPGSKVPTAKQTISPGSTANKESEKFRTTKG
SPSQSLPKPITMEKASASSCPGPLEGREAGQASSASCTMTVAQSSGQSTGNGAVQLPQQQ
QHSHPNTATVAPFIYRAHSENEGTSLPSADSCTSPTKMDLSYSKTAKQCLEEISGEDPET
RRMRTVKNIADLRQNLEETMSSLRGTQISHSTLETTFDSTVTTEVNGRSIPNLTSRPTPM
TWRLGQACPRLQAGDAPSLGAGYPRSGTSRFIHTDPSRFMYTTPLRRAAVSRLGNMSQID
MNEKASSDLDMSSEVDVGGYMSDGDILGKSLRTDDINSGYMTDGGLNLYTRSLNRIPDTA
SSRDVIQRGVHDVTVDADSWDDSSSVSSGLSDTLDNISTDDLNTSSVSSYSNITVPSRKN
TQLKTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLPEDPEKAGQKASL
SVSQTGSWRRGMSAQGGAQSRQKAGTSVLKTPGKTDDAKASEKGKAPLKGSSLQRSPSDA
GKSSGDEGKKPPSGIGRSTATSSFGFKKPSGVGSSAMITSSGATITSGSATLGKIPKSAA
IGGKSNAGRKTSLDGSQNQDDVVLHVSSKTTLHSQLARPSKSSTSGIPGRGGHRSSTSCV
DSIVSSKSAGAPTSILREPTKIGSGRSSPVTVNQTDEKEKVAVSDSESVSLSGSPKSSPT
SASACGAQGLRQPGSKYPDIASPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTTLA
RQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSDLTTDVISLSHSLASSPASVHSFTSGG
LVWAANMSSSSAGSKDTPSYQSMTSLHTSSESIDLPLSHHGSLSGLTTGTHEVQSLLMRT
GSVRSTLSESMQLDRNTLPKKGLRYTPSSRQANQEEGKEWLRSHSTGGLQDTGNQSPLVS
PSAMSSSAAGKYHFSNLVSPTNLSQFNLPGPSMMRSNSIPAQDSSFDLYDDSQLCGSATS
LEERPRAISHSGSFRDSMEEVHGSSLSLVSSTSSLYSTVSNGCCIQQIHKLRRELVASQE
KVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKAQNSA
AQAAIQGALNGPDHPPKDLRIRRQHSSESVSSINSATSHSSIGSGNDADSKKKKKKNWVN
SRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGDCSSASMKPSQS
ASASPLVWPPKKRQNGPVIYKHRSRICECTEAEAEIILQLKSELREKELKLTDIRLEALS
SAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPTRPPSESSSSTSSSSSRQSLG
LSLNNLNITEAVTSDILLDDAGDATGHKDGRSVKIIVSISKGYGRAKDQKSQAYLIGSIG
VSGKTKWDVLDGVIRRLFKEYVFRIDTSTSLGLSSDCIASYCIGDLIRSHNLEVPELLPC
GYLVGDNNVITVNLKGVEENSLDSFVFDTLIPKPITQRYFNLLMEHHRIILSGPSGTGKT
YLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQQYLANLAEQCSADNNGVELPVVI
ILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHHNFRWVLCANHTEP
VKGFLGRYLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGPRLF
LPCPMDVGSRVWFMDLWNYSLVPYILEAVREGLQMYGKRTPWEDPSKWVLDTYPWSSASL
PQESPALLQLRPEDVGYEGCTSTKEATTSKHIPQTDTEGDPLMNMLMKLQEAANYSSTQS
CDSESTSHHEDILDSSLESTL
Download sequence
Identical sequences 9544.ENSMMUP00000028092 ENSMMUP00000028093 ENSMMUP00000028092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]