SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000031800 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000031800
Domain Number 1 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.77e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 234-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-22
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 4 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 290-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 6 Region: 349-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 6-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.27e-20
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 8 Region: 196-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 584-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 10 Region: 149-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000188
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 11 Region: 393-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000243
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000031800
Sequence length 643
Comment (Macaca mulatta)
Sequence
LYTCGMFQDSVVFEDVAVNFTQEEWALLGPSQKKLYRDVMQETFVNLASIGKTEIIPSLS
QLENKCFLFINKVPRFRMLKGENWEEKNTEDHKNQGRKKIVAKKVFLKMVQVVQYLKNIS
PGNNIKKLYIMKEGSQFGETISQTPNPKPNKKTFTRVKPYECSMCGKDYMCHSSLNRHMR
SHTEHRSYEYHKYGEKSYECKECGKRFSFRSSFRIHERTHTGEKPYKCKQCGKAFSWPSS
FQIHERTHTGEKPYECKECGKAFIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPSSFRNH
ERTHSGEKPYECKQCGKAFRYYQTFQIHERTHTGEKPYQCKQCGKALSCPTSFRSHERIH
TGEKPYKCKKCGKAFSFPSSFRKHERIHTGEKPYDCKECGKAFISLPSYRRHMIMHTGNG
PYKCKECGKAFDCPSSFQIHERTHTGEKPFECKQCGKAFSCSSSFRMHERTHTGEKPHEC
KQCGKAFSCSSSVRIHERTHTGEKPYECKQCGKAFSCSSSFRMHERIHTGEKPYECKQCG
KAFSCSSSVRMHERTHTGEKPYECKQCDKAFSCSRSFRIHERTHTGEKPYACQQCGKAFK
CSRSFRIHERVHSGEKLYNCKECGKTFICLSLLGSHEQTHTGK
Download sequence
Identical sequences 9544.ENSMMUP00000031800 ENSMMUP00000006931 ENSMMUP00000031800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]