SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000034098 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000034098
Domain Number 1 Region: 18-159
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.23e-35
Family Calponin-homology domain, CH-domain 0.00000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000034098
Sequence length 197
Comment (Macaca mulatta)
Sequence
MANKGPSYGMSCEAQSRIEKKYDKGLEERLVEWIIVQYGPDVGCPDRGRLGFQLWLKNGG
VILSKLVNSLYPDGSTPVNLPENLPSMVFKQMGQVAQFLKAAEDYGVTKTDMFQTVDLFE
GKDMAAVQRTLMALGSLAVTKNDGYYRGDANWFMKKAQEHKREFTDSQLQEEKHIGSNRG
ASQAGMTCYRRPWQINS
Download sequence
Identical sequences ENSMMUP00000034098 9544.ENSMMUP00000034098 ENSMMUP00000034098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]