SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000034928 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000034928
Domain Number 1 Region: 13-128
Classification Level Classification E-value
Superfamily PX domain 2.22e-32
Family PX domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000034928
Sequence length 270
Comment (Macaca mulatta)
Sequence
MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRY
REFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDS
QLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKS
CCFLPRSGRRNSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLPPLSSPLCCDFGRPNEG
TSTLQSVRRAVGGDHAVPLDPGQLETVLEK
Download sequence
Identical sequences A0A2K5ZPA1 F7BF03 G7PU67
NP_001247714.1.72884 XP_005583608.1.63531 XP_005583609.1.63531 XP_011854734.1.47321 XP_011854735.1.47321 XP_011854736.1.47321 XP_014974866.1.72884 XP_014974867.1.72884 XP_015293692.1.63531 9544.ENSMMUP00000034928 ENSMMUP00000027186 ENSMMUP00000034928 ENSMMUP00000034929 ENSMMUP00000027186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]