SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000036659 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000036659
Domain Number 1 Region: 1-20,97-206
Classification Level Classification E-value
Superfamily SNARE-like 1.1e-34
Family Sedlin (SEDL) 0.0028
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000036659
Domain Number - Region: 53-97
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00132
Family PDZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000036659
Sequence length 219
Comment (Macaca mulatta)
Sequence
MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVG
HAVLAINGMDVNGKYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFA
IGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDF
ALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS
Download sequence
Identical sequences A0A0D9S3Q9 A0A2K5ITD8 A0A2K5RGJ7 A0A2K5U7B8 A0A2K5YW80 A0A2K6AU11 A0A2K6KD65 A0A2K6RHJ6 F7GR89 H9EPR2
9544.ENSMMUP00000036659 ENSPANP00000000290 ENSMMUP00000022279 ENSMMUP00000036659 NP_001244378.1.72884 XP_002754549.1.60252 XP_005579924.1.63531 XP_008019319.1.81039 XP_010355238.1.97406 XP_011730585.1.29376 XP_011782301.1.43180 XP_011820296.1.47321 XP_012325770.1.9421 XP_017378975.1.71028 XP_017726033.1.44346 ENSCJAP00000044313 ENSCJAP00000025213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]